All Genetegrate code. The folders are as follows:

sks2142 [2007-06-26 10:32:05]
All Genetegrate code. The folders are as follows:
1.geneWKspace - the eclipse workspace for all the code
2.GRA - all my gra stuff - the theoretical analysis, etc.
3.netblast-install - various installers for netblast
4.report - the pdf and odt versions of the report
Filename
geneWKspace/.metadata/.lock
geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/27/50edcbcf26ff001b1e04964c28b869e5
geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/4/3094baa526ff001b1e04964c28b869e5
geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/69/204fbfa526ff001b1e04964c28b869e5
geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/75/a0fff8c226ff001b1e04964c28b869e5
geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/8f/40c8d2b226ff001b1e04964c28b869e5
geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/a/80a1800e27ff001b1e04964c28b869e5
geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/b3/50235dd428ff001b1e04964c28b869e5
geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/d2/7087091e27ff001b1e04964c28b869e5
geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/e1/90fd04fb26ff001b1e04964c28b869e5
geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.projects/Genetegrate/.indexes/6e/history.index
geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.projects/Genetegrate/.indexes/e5/history.index
geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.projects/Genetegrate/.markers.snap
geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.projects/Genetegrate/.syncinfo.snap
geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.root/.indexes/properties.index
geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.root/.markers.snap
geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.safetable/org.eclipse.core.resources
geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.snap
geneWKspace/.metadata/.plugins/org.eclipse.core.runtime/.settings/org.eclipse.core.resources.prefs
geneWKspace/.metadata/.plugins/org.eclipse.core.runtime/.settings/org.eclipse.jdt.core.prefs
geneWKspace/.metadata/.plugins/org.eclipse.core.runtime/.settings/org.eclipse.jdt.ui.prefs
geneWKspace/.metadata/.plugins/org.eclipse.core.runtime/.settings/org.eclipse.ui.prefs
geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/164139957.index
geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/1873549465.index
geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/2272721862.index
geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/228062932.index
geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/2458627278.index
geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/272385801.index
geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/320325626.index
geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/3608186593.index
geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/3831187027.index
geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/3928800024.index
geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/725208138.index
geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/867501316.index
geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/externalLibsTimeStamps
geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/savedIndexNames.txt
geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/variablesAndContainers.dat
geneWKspace/.metadata/.plugins/org.eclipse.jdt.launching/libraryInfos.xml
geneWKspace/.metadata/.plugins/org.eclipse.ui.workbench/workbench.xml
geneWKspace/.metadata/.plugins/org.eclipse.ui.workbench/workingsets.xml
geneWKspace/.metadata/version.ini
geneWKspace/Genetegrate/.classpath
geneWKspace/Genetegrate/.project
geneWKspace/Genetegrate/ClientCopy0.blastpgp
geneWKspace/Genetegrate/ClientCopy1.blastpgp
geneWKspace/Genetegrate/ClientCopy2.blastpgp
geneWKspace/Genetegrate/ClientCopy3.blastpgp
geneWKspace/Genetegrate/ClientCopy4.blastpgp
geneWKspace/Genetegrate/compile.sh
geneWKspace/Genetegrate/fasta1.f
geneWKspace/Genetegrate/fasta2.f
geneWKspace/Genetegrate/fasta3.f
geneWKspace/Genetegrate/fasta4.f
geneWKspace/Genetegrate/fasta5.f
diff --git a/geneWKspace/.metadata/.lock b/geneWKspace/.metadata/.lock
new file mode 100644
index 0000000..e69de29
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/27/50edcbcf26ff001b1e04964c28b869e5 b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/27/50edcbcf26ff001b1e04964c28b869e5
new file mode 100644
index 0000000..85a570f
--- /dev/null
+++ b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/27/50edcbcf26ff001b1e04964c28b869e5
@@ -0,0 +1,3 @@
+0:0.5
+1:0.5
+2:0
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/4/3094baa526ff001b1e04964c28b869e5 b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/4/3094baa526ff001b1e04964c28b869e5
new file mode 100644
index 0000000..fee6374
--- /dev/null
+++ b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/4/3094baa526ff001b1e04964c28b869e5
@@ -0,0 +1,202 @@
+/**
+ * Wrapper to invoke SGE blast on GAIA.
+ */
+package source;
+
+import java.io.BufferedReader;
+import java.io.BufferedWriter;
+import java.io.FileReader;
+import java.io.FileWriter;
+import java.io.IOException;
+import java.io.InputStream;
+import java.io.InputStreamReader;
+import java.util.Timer;
+import java.util.TimerTask;
+import java.util.Hashtable;
+
+import middleware.QueueManager;
+
+
+public class InvokeSGEBlast extends Thread implements Invoker{
+	Process pro;
+
+	Job j;
+
+	static final String blastResultExt = ".blastpgp";
+
+	static final String blastPrefix = "SGE";
+
+	static final long timeout = 2 * 60 * 1000;
+        private Hashtable<String, String> requiredParams;
+        private Hashtable<String, String> optionalParams;
+
+	int timeoutCounter = 0;
+
+	class killBlast extends TimerTask {
+		public void run() {
+			System.out.println("Checking SGEBlast");
+			int status = checkResults();
+			if (status == 1) {
+				if (pro != null)
+					pro.destroy();
+				cleanUp();
+			} else if (timeoutCounter > 8) {
+				// Problems while reading output file. Set job as failed.
+				System.out.println("Blast job timed out");
+				// May have to trigger killing the job here
+				//j.setStatus(Job.FAILED);
+				QueueManager.notifyJobFailure(j);
+
+				if (pro != null)
+					pro.destroy();
+				cleanUp();
+			}
+			timeoutCounter++;
+		}
+
+		/**
+		 * Cleans up the temporary files once Cancel needs to be called
+		 */
+		void cleanUp(){
+			String fastaName = blastPrefix + j.getJobId() ;
+			java.io.File f = new java.io.File(fastaName + ".f");
+			if (f.exists()) {		// Delete file on exiting.
+				f.delete();
+			}
+			f = new java.io.File(fastaName+ ".sh");
+			if (f.exists()) {		// Delete file on exiting.
+				f.delete();
+			}
+			cancel();
+
+		}
+		/**
+		 * Checks for results in the file system.
+		 * @return 0 if results are absent, 1 otherwise.
+		 */
+		public int checkResults() {
+			int status = 0;
+			try {
+				System.out.println("Looking for " + "./" + j.getJobId()
+						+ blastResultExt);
+				BufferedReader in = new BufferedReader(new FileReader("./"
+						+ j.getJobId() + blastResultExt));
+
+				in.close();
+				// j.setBlastResult(jobResult.toString());
+				j.setStatus(Job.BLASTED);
+				System.out.println("**********SGEBlst: I'm done***********");
+				status = 1;
+			} catch (IOException e) {
+				System.out.println("Blast not finished yet" + timeoutCounter);
+			} finally {
+				return status;
+			}
+		}
+	}
+
+	/**
+	 * Constructor to initialize the job
+         * @param j incoming job
+         * @param requiredParams a hashtable of required parameters need to invoke netblast
+         * @param optionalParams a hashtable of optinal parameters need to invoke netblast
+
+	 */
+	public InvokeSGEBlast(Job j,  Hashtable<String, String> requiredParams, Hashtable <String, String> optionalParams) {
+		this.j = j;
+                this.requiredParams = requiredParams;
+                this.optionalParams = optionalParams;
+		writeFastaToFile();
+	}
+
+	public void run() {
+		String fastaName = blastPrefix + j.getJobId();
+		Timer t = new Timer();
+		BufferedWriter out;
+
+		try {
+			String command = requiredParams.get("command");
+			String program = requiredParams.get("program");
+			String maxAli = optionalParams.get("maxali");
+			String priority = optionalParams.get("priority");
+			StringBuffer shellCommand = new StringBuffer();
+			StringBuffer sgeCommand = new StringBuffer();
+
+			shellCommand.append(command);
+			shellCommand.append(" ./Code/");
+			shellCommand.append(fastaName + ".f");
+			if(maxAli != null)
+				shellCommand.append(" maxAli=" + maxAli);
+			shellCommand.append(" fileOut=./Code/" +  j.getJobId() + blastResultExt);
+
+			sgeCommand.append(program);
+			if(priority != null)
+				sgeCommand.append(" -p " + priority);
+			sgeCommand.append (" ./" + fastaName + ".sh");
+			out = new BufferedWriter(new FileWriter(fastaName + ".sh"));
+			System.out.println("Executing " + shellCommand.toString());
+			out.write(shellCommand.toString());
+			// out.write("");
+			out.newLine();
+			out.close();
+
+			System.out.println("about to call blast");
+			Runtime runner = Runtime.getRuntime();
+			t.schedule(new killBlast(), timeout, timeout);
+			// Check every 2 minutes for a file. Check 8 times
+			// Hence we wait for 16 mins before giving up
+
+			System.out.println("Executing "
+					+ sgeCommand.toString());
+			pro = runner.exec(sgeCommand.toString());
+
+			if (pro.waitFor() != 0) {
+				System.out.println("SGEBlast: Error while executing");
+
+				// Displaying error that SGEBlast returned.
+
+				InputStream is = pro.getErrorStream();
+				InputStreamReader isr = new InputStreamReader(is);
+				String line;
+				BufferedReader br = new BufferedReader(isr);
+				System.out.println("Error message from SGEBlast:");
+				while ((line = br.readLine()) != null) {
+					System.out.println(line);
+				}
+				//j.setStatus(Job.FAILED);
+				QueueManager.notifyJobFailure(j);
+			} else {
+				// j.setStatus(source.Job.BLASTED);
+				System.out.println("SGEBlast: Job Submitted");
+			}
+
+		} catch (Exception e) {
+			//System.out.println(e.getMessage());
+			QueueManager.notifyJobFailure(j);
+		} finally {
+			// checkResults();
+			pro.destroy();
+
+		}
+	}
+
+	/**
+	 * Write the fasta sequence to file.
+	 *
+	 */
+	void writeFastaToFile() {
+		try {
+			String fastaName = blastPrefix + j.getJobId();
+			System.out.println("SGEBlast: writing temp fasta input file: "
+					+ fastaName);
+			BufferedWriter out = new BufferedWriter(new FileWriter(fastaName
+					+ ".f"));
+			// out.write(">" + fastaName + " \n");
+			out.write(j.getFastaSequence());
+			out.close();
+		} catch (IOException e) {
+			e.printStackTrace();
+		}
+
+	}
+}
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/69/204fbfa526ff001b1e04964c28b869e5 b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/69/204fbfa526ff001b1e04964c28b869e5
new file mode 100644
index 0000000..f1d8e4f
--- /dev/null
+++ b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/69/204fbfa526ff001b1e04964c28b869e5
@@ -0,0 +1,164 @@
+/**
+ * Wrapper to invoke SGE blast on GAIA.
+ */
+package source;
+
+import java.io.BufferedReader;
+import java.io.BufferedWriter;
+import java.io.FileReader;
+import java.io.FileWriter;
+import java.io.IOException;
+import java.io.InputStream;
+import java.io.InputStreamReader;
+import java.util.Timer;
+import java.util.TimerTask;
+
+import middleware.QueueManager;
+
+
+public class InvokeSGEBlast extends Thread {
+	Process pro;
+
+	Job j;
+
+	static final String blastResultExt = ".blastpgp";
+
+	static final String blastPrefix = "SGE";
+
+	static final long timeout = 2 * 60 * 1000;
+
+	int timeoutCounter = 0;
+
+	class killBlast extends TimerTask {
+		public void run() {
+			System.out.println("Checking SGEBlast");
+			int status = checkResults();
+			if (status == 1) {
+				if (pro != null)
+					pro.destroy();
+				cancel();
+			} else if (timeoutCounter > 8) {
+				// Problems while reading output file. Set job as failed.
+				System.out.println("Blast job timed out");
+				// May have to trigger killing the job here
+				//j.setStatus(Job.FAILED);
+				QueueManager.notifyJobFailure(j);
+
+				if (pro != null)
+					pro.destroy();
+				cancel();
+			}
+			timeoutCounter++;
+		}
+
+		/**
+		 * Checks for results in the file system.
+		 * @return 0 if results are absent, 1 otherwise.
+		 */
+		public int checkResults() {
+			int status = 0;
+			try {
+				System.out.println("Looking for " + "./" + j.getJobId()
+						+ blastResultExt);
+				BufferedReader in = new BufferedReader(new FileReader("./"
+						+ j.getJobId() + blastResultExt));
+
+				in.close();
+				// j.setBlastResult(jobResult.toString());
+				j.setStatus(Job.BLASTED);
+				System.out.println("**********SGEBlst: I'm done***********");
+				status = 1;
+			} catch (IOException e) {
+				System.out.println("Blast not finished yet" + timeoutCounter);
+			} finally {
+				return status;
+			}
+		}
+	}
+
+	/**
+	 * Constructor
+	 */
+	public InvokeSGEBlast(Job j) {
+		this.j = j;
+		writeFastaToFile();
+	}
+
+	public void run() {
+		String fastaName = blastPrefix + j.getJobId();
+		Timer t = new Timer();
+		BufferedWriter out;
+		try {
+			out = new BufferedWriter(new FileWriter(fastaName + ".sh"));
+			System.out.println("Executing "
+					+ "/usr/pub/molbio/perl/blastpgp.pl " + "./Gene/"
+					+ fastaName + ".f" + " maxAli=3000 fileOut=" + "./Gene/"
+					+ fastaName + blastResultExt);
+			out.write("/usr/pub/molbio/perl/blastpgp.pl " + "./Gene/"
+					+ fastaName + ".f" + " maxAli=3000 fileOut=" + "./Gene/"
+					+ j.getJobId() + blastResultExt + "");
+			// out.write("");
+			out.newLine();
+			out.close();
+
+			System.out.println("about to call blast");
+			Runtime runner = Runtime.getRuntime();
+			t.schedule(new killBlast(), timeout, timeout);
+			// Check every 2 minutes for a file. Check 8 times
+			// Hence we wait for 16 mins before giving up
+
+			System.out.println("Executing "
+					+ "/opt/sge/bin/lx26-amd64/qsub -p 0.01 " + "./"
+					+ fastaName + ".sh");
+			pro = runner.exec("/opt/sge/bin/lx26-amd64/qsub -p 0.01 " + "./"
+					+ fastaName + ".sh");
+
+			if (pro.waitFor() != 0) {
+				System.out.println("SGEBlast: Error while executing");
+
+				// Displaying error that SGEBlast returned.
+
+				InputStream is = pro.getErrorStream();
+				InputStreamReader isr = new InputStreamReader(is);
+				String line;
+				BufferedReader br = new BufferedReader(isr);
+				System.out.println("Error message from SGEBlast:");
+				while ((line = br.readLine()) != null) {
+					System.out.println(line);
+				}
+				//j.setStatus(Job.FAILED);
+				QueueManager.notifyJobFailure(j);
+			} else {
+				// j.setStatus(source.Job.BLASTED);
+				System.out.println("SGEBlast: Job Submitted");
+			}
+
+		} catch (Exception e) {
+			//System.out.println(e.getMessage());
+			QueueManager.notifyJobFailure(j);
+		} finally {
+			// checkResults();
+			pro.destroy();
+		}
+	}
+
+	/**
+	 * Write the fasta sequence to file.
+	 *
+	 */
+	void writeFastaToFile() {
+		try {
+			String fastaName = blastPrefix + j.getJobId();
+			System.out.println("SGEBlast: writing temp fasta input file: "
+					+ fastaName);
+			BufferedWriter out = new BufferedWriter(new FileWriter(fastaName
+					+ ".f"));
+			// out.write(">" + fastaName + " \n");
+			out.write(j.getFastaSequence());
+			out.close();
+		} catch (IOException e) {
+			e.printStackTrace();
+		}
+
+	}
+}
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/75/a0fff8c226ff001b1e04964c28b869e5 b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/75/a0fff8c226ff001b1e04964c28b869e5
new file mode 100644
index 0000000..142748f
--- /dev/null
+++ b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/75/a0fff8c226ff001b1e04964c28b869e5
@@ -0,0 +1,3 @@
+0:1.0
+1:0
+2:0
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/8f/40c8d2b226ff001b1e04964c28b869e5 b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/8f/40c8d2b226ff001b1e04964c28b869e5
new file mode 100644
index 0000000..85a570f
--- /dev/null
+++ b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/8f/40c8d2b226ff001b1e04964c28b869e5
@@ -0,0 +1,3 @@
+0:0.5
+1:0.5
+2:0
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/a/80a1800e27ff001b1e04964c28b869e5 b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/a/80a1800e27ff001b1e04964c28b869e5
new file mode 100644
index 0000000..a954a6e
--- /dev/null
+++ b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/a/80a1800e27ff001b1e04964c28b869e5
@@ -0,0 +1,8 @@
+<servers>
+<server id="0" name="ncbi netblast"><parameters><parameter required="true" name="classname">InvokeNetBlast</parameter><parameter required="true" name="command">C:\\netblast-2.2.16\\blastcl3</parameter><parameter required="false" name="program">blastp</parameter></parameters>
+</server>
+<server id="1" name="SGE Blast"><parameters><parameter required="true"
+name="classname">InvokeSGEBlast</parameter><parameter required="true"
+name="command">/usr/pub/molbio/perl/blastpgp.pl</parameter><parameter required="false" name="maxali">3000</parameter><parameter required="true" name="program">/opt/sge/bin/lx26-amd64/qsub</parameter><parameter required="false" name="priority">0.01</parameter></parameters>
+</server>
+</servers>
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/b3/50235dd428ff001b1e04964c28b869e5 b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/b3/50235dd428ff001b1e04964c28b869e5
new file mode 100644
index 0000000..a954a6e
--- /dev/null
+++ b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/b3/50235dd428ff001b1e04964c28b869e5
@@ -0,0 +1,8 @@
+<servers>
+<server id="0" name="ncbi netblast"><parameters><parameter required="true" name="classname">InvokeNetBlast</parameter><parameter required="true" name="command">C:\\netblast-2.2.16\\blastcl3</parameter><parameter required="false" name="program">blastp</parameter></parameters>
+</server>
+<server id="1" name="SGE Blast"><parameters><parameter required="true"
+name="classname">InvokeSGEBlast</parameter><parameter required="true"
+name="command">/usr/pub/molbio/perl/blastpgp.pl</parameter><parameter required="false" name="maxali">3000</parameter><parameter required="true" name="program">/opt/sge/bin/lx26-amd64/qsub</parameter><parameter required="false" name="priority">0.01</parameter></parameters>
+</server>
+</servers>
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/d2/7087091e27ff001b1e04964c28b869e5 b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/d2/7087091e27ff001b1e04964c28b869e5
new file mode 100644
index 0000000..f9319d4
--- /dev/null
+++ b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/d2/7087091e27ff001b1e04964c28b869e5
@@ -0,0 +1,8 @@
+<servers>
+<server id="0" name="ncbi netblast"><parameters><parameter required="true" name="classname">InvokeNetBlast</parameter><parameter required="true" name="command">/nfs/home1/ssheth/netblast-2.2.16/bin/blastcl3</parameter><parameter required="false" name="program">blastp</parameter></parameters>
+</server>
+<server id="1" name="SGE Blast"><parameters><parameter required="true"
+name="classname">InvokeSGEBlast</parameter><parameter required="true"
+name="command">/usr/pub/molbio/perl/blastpgp.pl</parameter><parameter required="false" name="maxali">3000</parameter><parameter required="true" name="program">/opt/sge/bin/lx26-amd64/qsub</parameter><parameter required="false" name="priority">0.01</parameter></parameters>
+</server>
+</servers>
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/e1/90fd04fb26ff001b1e04964c28b869e5 b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/e1/90fd04fb26ff001b1e04964c28b869e5
new file mode 100644
index 0000000..f9319d4
--- /dev/null
+++ b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.history/e1/90fd04fb26ff001b1e04964c28b869e5
@@ -0,0 +1,8 @@
+<servers>
+<server id="0" name="ncbi netblast"><parameters><parameter required="true" name="classname">InvokeNetBlast</parameter><parameter required="true" name="command">/nfs/home1/ssheth/netblast-2.2.16/bin/blastcl3</parameter><parameter required="false" name="program">blastp</parameter></parameters>
+</server>
+<server id="1" name="SGE Blast"><parameters><parameter required="true"
+name="classname">InvokeSGEBlast</parameter><parameter required="true"
+name="command">/usr/pub/molbio/perl/blastpgp.pl</parameter><parameter required="false" name="maxali">3000</parameter><parameter required="true" name="program">/opt/sge/bin/lx26-amd64/qsub</parameter><parameter required="false" name="priority">0.01</parameter></parameters>
+</server>
+</servers>
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.projects/Genetegrate/.indexes/6e/history.index b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.projects/Genetegrate/.indexes/6e/history.index
new file mode 100644
index 0000000..108c6bc
Binary files /dev/null and b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.projects/Genetegrate/.indexes/6e/history.index differ
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.projects/Genetegrate/.indexes/e5/history.index b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.projects/Genetegrate/.indexes/e5/history.index
new file mode 100644
index 0000000..ed7d61e
Binary files /dev/null and b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.projects/Genetegrate/.indexes/e5/history.index differ
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.projects/Genetegrate/.markers.snap b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.projects/Genetegrate/.markers.snap
new file mode 100644
index 0000000..a04ec6c
Binary files /dev/null and b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.projects/Genetegrate/.markers.snap differ
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.projects/Genetegrate/.syncinfo.snap b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.projects/Genetegrate/.syncinfo.snap
new file mode 100644
index 0000000..3ab7083
Binary files /dev/null and b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.projects/Genetegrate/.syncinfo.snap differ
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.root/.indexes/properties.index b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.root/.indexes/properties.index
new file mode 100644
index 0000000..c168f75
Binary files /dev/null and b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.root/.indexes/properties.index differ
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.root/.markers.snap b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.root/.markers.snap
new file mode 100644
index 0000000..3ab7083
Binary files /dev/null and b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.root/.markers.snap differ
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.safetable/org.eclipse.core.resources b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.safetable/org.eclipse.core.resources
new file mode 100644
index 0000000..d028717
Binary files /dev/null and b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.safetable/org.eclipse.core.resources differ
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.snap b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.snap
new file mode 100644
index 0000000..a35a8d6
Binary files /dev/null and b/geneWKspace/.metadata/.plugins/org.eclipse.core.resources/.snap differ
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.core.runtime/.settings/org.eclipse.core.resources.prefs b/geneWKspace/.metadata/.plugins/org.eclipse.core.runtime/.settings/org.eclipse.core.resources.prefs
new file mode 100644
index 0000000..e6315cc
--- /dev/null
+++ b/geneWKspace/.metadata/.plugins/org.eclipse.core.runtime/.settings/org.eclipse.core.resources.prefs
@@ -0,0 +1,3 @@
+#Thu May 10 14:44:44 EDT 2007
+version=1
+eclipse.preferences.version=1
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.core.runtime/.settings/org.eclipse.jdt.core.prefs b/geneWKspace/.metadata/.plugins/org.eclipse.core.runtime/.settings/org.eclipse.jdt.core.prefs
new file mode 100644
index 0000000..6a7e8ec
--- /dev/null
+++ b/geneWKspace/.metadata/.plugins/org.eclipse.core.runtime/.settings/org.eclipse.jdt.core.prefs
@@ -0,0 +1,8 @@
+#Thu May 10 14:44:38 EDT 2007
+org.eclipse.jdt.core.compiler.problem.enumIdentifier=error
+org.eclipse.jdt.core.compiler.codegen.targetPlatform=1.5
+eclipse.preferences.version=1
+org.eclipse.jdt.core.builder.resourceCopyExclusionFilter=*.launch
+org.eclipse.jdt.core.compiler.problem.assertIdentifier=error
+org.eclipse.jdt.core.compiler.source=1.5
+org.eclipse.jdt.core.compiler.compliance=1.5
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.core.runtime/.settings/org.eclipse.jdt.ui.prefs b/geneWKspace/.metadata/.plugins/org.eclipse.core.runtime/.settings/org.eclipse.jdt.ui.prefs
new file mode 100644
index 0000000..9f2aac0
--- /dev/null
+++ b/geneWKspace/.metadata/.plugins/org.eclipse.core.runtime/.settings/org.eclipse.jdt.ui.prefs
@@ -0,0 +1,10 @@
+#Thu May 10 14:44:20 EDT 2007
+useQuickDiffPrefPage=true
+tabWidthPropagated=true
+org.eclipse.jdt.ui.javadoclocations.migrated=true
+useAnnotationsPrefPage=true
+org.eclipse.jface.textfont=1|Courier New|10|0|WINDOWS|1|0|0|0|0|0|0|0|0|1|0|0|0|0|Courier New;
+org.eclipse.jdt.ui.editor.tab.width=
+org.eclipse.jdt.ui.formatterprofiles.version=10
+eclipse.preferences.version=1
+fontPropagated=true
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.core.runtime/.settings/org.eclipse.ui.prefs b/geneWKspace/.metadata/.plugins/org.eclipse.core.runtime/.settings/org.eclipse.ui.prefs
new file mode 100644
index 0000000..4665050
--- /dev/null
+++ b/geneWKspace/.metadata/.plugins/org.eclipse.core.runtime/.settings/org.eclipse.ui.prefs
@@ -0,0 +1,3 @@
+#Thu May 10 14:44:24 EDT 2007
+eclipse.preferences.version=1
+showIntro=false
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/164139957.index b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/164139957.index
new file mode 100644
index 0000000..8946fe1
Binary files /dev/null and b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/164139957.index differ
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/1873549465.index b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/1873549465.index
new file mode 100644
index 0000000..3188d08
Binary files /dev/null and b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/1873549465.index differ
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/2272721862.index b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/2272721862.index
new file mode 100644
index 0000000..d66cb6c
Binary files /dev/null and b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/2272721862.index differ
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/228062932.index b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/228062932.index
new file mode 100644
index 0000000..cb27bc6
Binary files /dev/null and b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/228062932.index differ
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/2458627278.index b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/2458627278.index
new file mode 100644
index 0000000..785882b
Binary files /dev/null and b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/2458627278.index differ
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/272385801.index b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/272385801.index
new file mode 100644
index 0000000..75afe5c
Binary files /dev/null and b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/272385801.index differ
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/320325626.index b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/320325626.index
new file mode 100644
index 0000000..d50f0d2
Binary files /dev/null and b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/320325626.index differ
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/3608186593.index b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/3608186593.index
new file mode 100644
index 0000000..51fcd09
Binary files /dev/null and b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/3608186593.index differ
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/3831187027.index b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/3831187027.index
new file mode 100644
index 0000000..c32a257
Binary files /dev/null and b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/3831187027.index differ
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/3928800024.index b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/3928800024.index
new file mode 100644
index 0000000..f4b7e20
Binary files /dev/null and b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/3928800024.index differ
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/725208138.index b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/725208138.index
new file mode 100644
index 0000000..a5601a7
Binary files /dev/null and b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/725208138.index differ
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/867501316.index b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/867501316.index
new file mode 100644
index 0000000..b6006a1
Binary files /dev/null and b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/867501316.index differ
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/externalLibsTimeStamps b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/externalLibsTimeStamps
new file mode 100644
index 0000000..aae9ac6
Binary files /dev/null and b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/externalLibsTimeStamps differ
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/savedIndexNames.txt b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/savedIndexNames.txt
new file mode 100644
index 0000000..ecf7e30
--- /dev/null
+++ b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/savedIndexNames.txt
@@ -0,0 +1,11 @@
+C:\geneWKspace\.metadata\.plugins\org.eclipse.jdt.core\2458627278.index
+C:\geneWKspace\.metadata\.plugins\org.eclipse.jdt.core\2272721862.index
+C:\geneWKspace\.metadata\.plugins\org.eclipse.jdt.core\272385801.index
+C:\geneWKspace\.metadata\.plugins\org.eclipse.jdt.core\1873549465.index
+C:\geneWKspace\.metadata\.plugins\org.eclipse.jdt.core\725208138.index
+C:\geneWKspace\.metadata\.plugins\org.eclipse.jdt.core\867501316.index
+C:\geneWKspace\.metadata\.plugins\org.eclipse.jdt.core\3831187027.index
+C:\geneWKspace\.metadata\.plugins\org.eclipse.jdt.core\3928800024.index
+C:\geneWKspace\.metadata\.plugins\org.eclipse.jdt.core\228062932.index
+C:\geneWKspace\.metadata\.plugins\org.eclipse.jdt.core\3608186593.index
+C:\geneWKspace\.metadata\.plugins\org.eclipse.jdt.core\164139957.index
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/variablesAndContainers.dat b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/variablesAndContainers.dat
new file mode 100644
index 0000000..2f83ab1
Binary files /dev/null and b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.core/variablesAndContainers.dat differ
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.jdt.launching/libraryInfos.xml b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.launching/libraryInfos.xml
new file mode 100644
index 0000000..5e37f8e
--- /dev/null
+++ b/geneWKspace/.metadata/.plugins/org.eclipse.jdt.launching/libraryInfos.xml
@@ -0,0 +1,37 @@
+<?xml version="1.0" encoding="UTF-8"?>
+<libraryInfos>
+<libraryInfo home="C:\Program Files\Java\jdk1.5.0_11" version="1.5.0_11">
+<bootpath>
+<entry path="C:\Program Files\Java\jdk1.5.0_11\jre\lib\rt.jar"/>
+<entry path="C:\Program Files\Java\jdk1.5.0_11\jre\lib\i18n.jar"/>
+<entry path="C:\Program Files\Java\jdk1.5.0_11\jre\lib\sunrsasign.jar"/>
+<entry path="C:\Program Files\Java\jdk1.5.0_11\jre\lib\jsse.jar"/>
+<entry path="C:\Program Files\Java\jdk1.5.0_11\jre\lib\jce.jar"/>
+<entry path="C:\Program Files\Java\jdk1.5.0_11\jre\lib\charsets.jar"/>
+<entry path="C:\Program Files\Java\jdk1.5.0_11\jre\classes"/>
+</bootpath>
+<extensionDirs>
+<entry path="C:\Program Files\Java\jdk1.5.0_11\jre\lib\ext"/>
+</extensionDirs>
+<endorsedDirs>
+<entry path="C:\Program Files\Java\jdk1.5.0_11\jre\lib\endorsed"/>
+</endorsedDirs>
+</libraryInfo>
+<libraryInfo home="C:\Program Files\Java\jdk1.5.0_11\jre" version="1.5.0_11">
+<bootpath>
+<entry path="C:\Program Files\Java\jdk1.5.0_11\jre\lib\rt.jar"/>
+<entry path="C:\Program Files\Java\jdk1.5.0_11\jre\lib\i18n.jar"/>
+<entry path="C:\Program Files\Java\jdk1.5.0_11\jre\lib\sunrsasign.jar"/>
+<entry path="C:\Program Files\Java\jdk1.5.0_11\jre\lib\jsse.jar"/>
+<entry path="C:\Program Files\Java\jdk1.5.0_11\jre\lib\jce.jar"/>
+<entry path="C:\Program Files\Java\jdk1.5.0_11\jre\lib\charsets.jar"/>
+<entry path="C:\Program Files\Java\jdk1.5.0_11\jre\classes"/>
+</bootpath>
+<extensionDirs>
+<entry path="C:\Program Files\Java\jdk1.5.0_11\jre\lib\ext"/>
+</extensionDirs>
+<endorsedDirs>
+<entry path="C:\Program Files\Java\jdk1.5.0_11\jre\lib\endorsed"/>
+</endorsedDirs>
+</libraryInfo>
+</libraryInfos>
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.ui.workbench/workbench.xml b/geneWKspace/.metadata/.plugins/org.eclipse.ui.workbench/workbench.xml
new file mode 100644
index 0000000..2c7b3a0
--- /dev/null
+++ b/geneWKspace/.metadata/.plugins/org.eclipse.ui.workbench/workbench.xml
@@ -0,0 +1,314 @@
+<?xml version="1.0" encoding="UTF-8"?>
+<workbench progressCount="15" version="2.0">
+<workbenchAdvisor/>
+<window height="768" maximized="true" width="1024" x="176" y="176">
+<fastViewData fastViewLocation="1024"/>
+<perspectiveBar>
+<itemSize x="160"/>
+</perspectiveBar>
+<coolbarLayout locked="0">
+<coolItem id="group.file" itemType="typeGroupMarker"/>
+<coolItem id="org.eclipse.ui.workbench.file" itemType="typeToolBarContribution" x="98" y="22"/>
+<coolItem id="additions" itemType="typeGroupMarker"/>
+<coolItem id="org.eclipse.debug.ui.launchActionSet" itemType="typeToolBarContribution" x="124" y="22"/>
+<coolItem id="org.eclipse.jdt.ui.JavaElementCreationActionSet" itemType="typeToolBarContribution" x="98" y="22"/>
+<coolItem id="org.eclipse.search.searchActionSet" itemType="typeToolBarContribution" x="61" y="22"/>
+<coolItem id="org.eclipse.ui.WorkingSetActionSet" itemType="typeToolBarContribution" x="50" y="22"/>
+<coolItem id="group.nav" itemType="typeGroupMarker"/>
+<coolItem id="org.eclipse.ui.workbench.navigate" itemType="typeToolBarContribution" x="185" y="22"/>
+<coolItem id="group.editor" itemType="typeGroupMarker"/>
+<coolItem id="org.eclipse.ui.DefaultTextEditor" itemType="typeToolBarContribution" x="-1" y="-1"/>
+<coolItem id="group.help" itemType="typeGroupMarker"/>
+<coolItem id="org.eclipse.ui.workbench.help" itemType="typeToolBarContribution" x="-1" y="-1"/>
+</coolbarLayout>
+<page aggregateWorkingSetId="Aggregate for window 1178822662468" focus="true" label="Workspace - Java">
+<editors>
+<editorArea activeWorkbook="DefaultEditorWorkbook">
+<info part="DefaultEditorWorkbook">
+<folder appearance="1" expanded="2">
+<presentation id="org.eclipse.ui.presentations.WorkbenchPresentationFactory">
+<part id="0"/>
+<part id="1"/>
+<part id="2"/>
+<part id="3"/>
+<part id="4"/>
+</presentation>
+</folder>
+</info>
+</editorArea>
+<editor id="org.eclipse.ui.DefaultTextEditor" name="ClientCopy0.blastpgp" partName="ClientCopy0.blastpgp" path="C:/geneWKspace/Genetegrate/ClientCopy0.blastpgp" title="ClientCopy0.blastpgp" tooltip="Genetegrate/ClientCopy0.blastpgp" workbook="DefaultEditorWorkbook">
+<input factoryID="org.eclipse.ui.part.FileEditorInputFactory" path="/Genetegrate/ClientCopy0.blastpgp"/>
+</editor>
+<editor id="org.eclipse.ui.DefaultTextEditor" name="ClientCopy1.blastpgp" partName="ClientCopy1.blastpgp" path="C:/geneWKspace/Genetegrate/ClientCopy1.blastpgp" title="ClientCopy1.blastpgp" tooltip="Genetegrate/ClientCopy1.blastpgp" workbook="DefaultEditorWorkbook">
+<input factoryID="org.eclipse.ui.part.FileEditorInputFactory" path="/Genetegrate/ClientCopy1.blastpgp"/>
+</editor>
+<editor id="org.eclipse.ui.DefaultTextEditor" name="ClientCopy2.blastpgp" partName="ClientCopy2.blastpgp" path="C:/geneWKspace/Genetegrate/ClientCopy2.blastpgp" title="ClientCopy2.blastpgp" tooltip="Genetegrate/ClientCopy2.blastpgp" workbook="DefaultEditorWorkbook">
+<input factoryID="org.eclipse.ui.part.FileEditorInputFactory" path="/Genetegrate/ClientCopy2.blastpgp"/>
+</editor>
+<editor id="org.eclipse.ui.DefaultTextEditor" name="ClientCopy3.blastpgp" partName="ClientCopy3.blastpgp" path="C:/geneWKspace/Genetegrate/ClientCopy3.blastpgp" title="ClientCopy3.blastpgp" tooltip="Genetegrate/ClientCopy3.blastpgp" workbook="DefaultEditorWorkbook">
+<input factoryID="org.eclipse.ui.part.FileEditorInputFactory" path="/Genetegrate/ClientCopy3.blastpgp"/>
+</editor>
+<editor activePart="true" focus="true" id="org.eclipse.ui.DefaultTextEditor" name="ClientCopy4.blastpgp" partName="ClientCopy4.blastpgp" path="C:/geneWKspace/Genetegrate/ClientCopy4.blastpgp" title="ClientCopy4.blastpgp" tooltip="Genetegrate/ClientCopy4.blastpgp" workbook="DefaultEditorWorkbook">
+<input factoryID="org.eclipse.ui.part.FileEditorInputFactory" path="/Genetegrate/ClientCopy4.blastpgp"/>
+</editor>
+</editors>
+<views>
+<view id="org.eclipse.jdt.ui.JavadocView" partName="Javadoc"/>
+<view id="org.eclipse.ui.views.ContentOutline" partName="Outline">
+<viewState/>
+</view>
+<view id="org.eclipse.jdt.ui.SourceView" partName="Declaration"/>
+<view id="org.eclipse.jdt.ui.PackageExplorer" partName="Package Explorer">
+<viewState isWindowWorkingSet="true" layout="2" org.eclipse.jdt.ui.packages.linktoeditor="0" rootMode="1" workingSetName="">
+<customFilters userDefinedPatternsEnabled="false">
+<xmlDefinedFilters>
+<child filterId="org.eclipse.jdt.ui.PackageExplorer.FieldsFilter" isEnabled="false"/>
+<child filterId="org.eclipse.jdt.ui.PackageExplorer_patternFilterId_.*" isEnabled="true"/>
+<child filterId="org.eclipse.jdt.ui.PackageExplorer.LocalTypesFilter" isEnabled="false"/>
+<child filterId="org.eclipse.jdt.ui.PackageExplorer_patternFilterId_*$*.class" isEnabled="true"/>
+<child filterId="org.eclipse.jdt.ui.PackageExplorer.NonPublicFilter" isEnabled="false"/>
+<child filterId="org.eclipse.jdt.internal.ui.PackageExplorer.EmptyPackageFilter" isEnabled="false"/>
+<child filterId="org.eclipse.jdt.ui.PackageExplorer.LibraryFilter" isEnabled="false"/>
+<child filterId="org.eclipse.jdt.ui.PackageExplorer.NonJavaProjectsFilter" isEnabled="false"/>
+<child filterId="org.eclipse.jdt.ui.PackageExplorer.ContainedLibraryFilter" isEnabled="false"/>
+<child filterId="org.eclipse.jdt.ui.PackageExplorer.ImportDeclarationFilter" isEnabled="true"/>
+<child filterId="org.eclipse.jdt.ui.PackageExplorer.StaticsFilter" isEnabled="false"/>
+<child filterId="org.eclipse.jdt.ui.PackageExplorer.NonSharedProjectsFilter" isEnabled="false"/>
+<child filterId="org.eclipse.jdt.internal.ui.PackageExplorer.EmptyInnerPackageFilter" isEnabled="true"/>
+<child filterId="org.eclipse.jdt.ui.PackageExplorer.SyntheticMembersFilter" isEnabled="true"/>
+<child filterId="org.eclipse.jdt.ui.PackageExplorer.NonJavaElementFilter" isEnabled="false"/>
+<child filterId="org.eclipse.jdt.ui.PackageExplorer.ClosedProjectsFilter" isEnabled="false"/>
+<child filterId="org.eclipse.jdt.ui.PackageExplorer.CuAndClassFileFilter" isEnabled="false"/>
+<child filterId="org.eclipse.pde.ui.BinaryProjectFilter1" isEnabled="false"/>
+<child filterId="org.eclipse.jdt.ui.PackageExplorer.PackageDeclarationFilter" isEnabled="true"/>
+</xmlDefinedFilters>
+</customFilters>
+</viewState>
+</view>
+<view id="org.eclipse.jdt.ui.TypeHierarchy" partName="Hierarchy"/>
+<view id="org.eclipse.ui.views.ProblemView" partName="Problems">
+<viewState columnWidth0="253" columnWidth1="78" columnWidth2="153" columnWidth3="63" columnWidth4="0" horizontalPosition="0" verticalPosition="0">
+<columnOrder columnOrderIndex="0"/>
+<columnOrder columnOrderIndex="1"/>
+<columnOrder columnOrderIndex="2"/>
+<columnOrder columnOrderIndex="3"/>
+<columnOrder columnOrderIndex="4"/>
+</viewState>
+</view>
+</views>
+<perspectives activePart="org.eclipse.ui.DefaultTextEditor" activePerspective="org.eclipse.jdt.ui.JavaPerspective">
+<perspective editorAreaVisible="1" fixed="0" version="0.016">
+<descriptor class="org.eclipse.jdt.internal.ui.JavaPerspectiveFactory" id="org.eclipse.jdt.ui.JavaPerspective" label="Java"/>
+<alwaysOnActionSet id="org.eclipse.ui.cheatsheets.actionSet"/>
+<alwaysOnActionSet id="org.eclipse.search.searchActionSet"/>
+<alwaysOnActionSet id="org.eclipse.ui.edit.text.actionSet.openExternalFile"/>
+<alwaysOnActionSet id="org.eclipse.ui.edit.text.actionSet.annotationNavigation"/>
+<alwaysOnActionSet id="org.eclipse.ui.edit.text.actionSet.navigation"/>
+<alwaysOnActionSet id="org.eclipse.ui.edit.text.actionSet.convertLineDelimitersTo"/>
+<alwaysOnActionSet id="org.eclipse.ui.externaltools.ExternalToolsSet"/>
+<alwaysOnActionSet id="org.eclipse.ui.actionSet.keyBindings"/>
+<alwaysOnActionSet id="org.eclipse.ui.WorkingSetActionSet"/>
+<alwaysOnActionSet id="org.eclipse.update.ui.softwareUpdates"/>
+<alwaysOnActionSet id="org.eclipse.debug.ui.launchActionSet"/>
+<alwaysOnActionSet id="org.eclipse.jdt.ui.JavaActionSet"/>
+<alwaysOnActionSet id="org.eclipse.jdt.ui.JavaElementCreationActionSet"/>
+<alwaysOnActionSet id="org.eclipse.ui.NavigateActionSet"/>
+<alwaysOnActionSet id="org.eclipse.debug.ui.breakpointActionSet"/>
+<alwaysOnActionSet id="org.eclipse.jdt.debug.ui.JDTDebugActionSet"/>
+<alwaysOnActionSet id="org.eclipse.jdt.junit.JUnitActionSet"/>
+<show_view_action id="org.eclipse.jdt.ui.PackageExplorer"/>
+<show_view_action id="org.eclipse.jdt.ui.TypeHierarchy"/>
+<show_view_action id="org.eclipse.jdt.ui.SourceView"/>
+<show_view_action id="org.eclipse.jdt.ui.JavadocView"/>
+<show_view_action id="org.eclipse.search.ui.views.SearchView"/>
+<show_view_action id="org.eclipse.ui.console.ConsoleView"/>
+<show_view_action id="org.eclipse.ui.views.ContentOutline"/>
+<show_view_action id="org.eclipse.ui.views.ProblemView"/>
+<show_view_action id="org.eclipse.ui.views.ResourceNavigator"/>
+<show_view_action id="org.eclipse.ui.views.TaskList"/>
+<show_view_action id="org.eclipse.ui.views.ProgressView"/>
+<show_view_action id="org.eclipse.ant.ui.views.AntView"/>
+<show_view_action id="org.eclipse.pde.runtime.LogView"/>
+<new_wizard_action id="org.eclipse.jdt.ui.wizards.NewPackageCreationWizard"/>
+<new_wizard_action id="org.eclipse.jdt.ui.wizards.NewClassCreationWizard"/>
+<new_wizard_action id="org.eclipse.jdt.ui.wizards.NewInterfaceCreationWizard"/>
+<new_wizard_action id="org.eclipse.jdt.ui.wizards.NewEnumCreationWizard"/>
+<new_wizard_action id="org.eclipse.jdt.ui.wizards.NewAnnotationCreationWizard"/>
+<new_wizard_action id="org.eclipse.jdt.ui.wizards.NewSourceFolderCreationWizard"/>
+<new_wizard_action id="org.eclipse.jdt.ui.wizards.NewSnippetFileCreationWizard"/>
+<new_wizard_action id="org.eclipse.ui.wizards.new.folder"/>
+<new_wizard_action id="org.eclipse.ui.wizards.new.file"/>
+<new_wizard_action id="org.eclipse.ui.editors.wizards.UntitledTextFileWizard"/>
+<new_wizard_action id="org.eclipse.jdt.junit.wizards.NewTestCaseCreationWizard"/>
+<perspective_action id="org.eclipse.jdt.ui.JavaPerspective"/>
+<perspective_action id="org.eclipse.debug.ui.DebugPerspective"/>
+<perspective_action id="org.eclipse.jdt.ui.JavaBrowsingPerspective"/>
+<view id="org.eclipse.jdt.ui.PackageExplorer"/>
+<view id="org.eclipse.jdt.ui.TypeHierarchy"/>
+<view id="org.eclipse.ui.views.ProblemView"/>
+<view id="org.eclipse.jdt.ui.JavadocView"/>
+<view id="org.eclipse.jdt.ui.SourceView"/>
+<view id="org.eclipse.ui.views.ContentOutline"/>
+<layout>
+<mainWindow>
+<info folder="true" part="left">
+<folder activePageID="org.eclipse.jdt.ui.PackageExplorer" appearance="2" expanded="2">
+<page content="org.eclipse.jdt.ui.PackageExplorer" label="Package Explorer"/>
+<page content="org.eclipse.jdt.ui.TypeHierarchy" label="Hierarchy"/>
+<page content="org.eclipse.ui.views.ResourceNavigator" label="LabelNotFound"/>
+<page content="org.eclipse.jdt.junit.ResultView" label="LabelNotFound"/>
+<presentation id="org.eclipse.ui.presentations.WorkbenchPresentationFactory">
+<part id="0"/>
+<part id="1"/>
+</presentation>
+</folder>
+</info>
+<info folder="true" part="org.eclipse.ui.internal.ViewStack@17d2f0e" ratio="0.74950296" ratioLeft="754" ratioRight="252" relationship="2" relative="left">
+<folder appearance="2" expanded="2">
+<page content="org.eclipse.help.ui.HelpView" label="LabelNotFound"/>
+<page content="org.eclipse.ui.internal.introview" label="LabelNotFound"/>
+<page content="org.eclipse.ui.cheatsheets.views.CheatSheetView" label="LabelNotFound"/>
+<presentation id="org.eclipse.ui.presentations.WorkbenchPresentationFactory"/>
+</folder>
+</info>
+<info part="org.eclipse.ui.editorss" ratio="0.24950299" ratioLeft="251" ratioRight="755" relationship="2" relative="left"/>
+<info folder="true" part="bottom" ratio="0.74930364" ratioLeft="538" ratioRight="180" relationship="4" relative="org.eclipse.ui.editorss">
+<folder activePageID="org.eclipse.ui.views.ProblemView" appearance="2" expanded="2">
+<page content="org.eclipse.ui.views.ProblemView" label="Problems"/>
+<page content="org.eclipse.jdt.ui.JavadocView" label="Javadoc"/>
+<page content="org.eclipse.jdt.ui.SourceView" label="Declaration"/>
+<page content="org.eclipse.search.ui.views.SearchView" label="LabelNotFound"/>
+<page content="org.eclipse.ui.console.ConsoleView" label="LabelNotFound"/>
+<page content="org.eclipse.ui.views.BookmarkView" label="LabelNotFound"/>
+<page content="org.eclipse.ui.views.ProgressView" label="LabelNotFound"/>
+<presentation id="org.eclipse.ui.presentations.WorkbenchPresentationFactory">
+<part id="0"/>
+<part id="1"/>
+<part id="2"/>
+</presentation>
+</folder>
+</info>
+<info folder="true" part="org.eclipse.ui.internal.ViewStack@1b595f3" ratio="0.7496689" ratioLeft="566" ratioRight="189" relationship="2" relative="org.eclipse.ui.editorss">
+<folder activePageID="org.eclipse.ui.views.ContentOutline" appearance="2" expanded="2">
+<page content="org.eclipse.ui.views.ContentOutline" label="Outline"/>
+<page content="org.eclipse.ant.ui.views.AntView" label="LabelNotFound"/>
+<presentation id="org.eclipse.ui.presentations.WorkbenchPresentationFactory">
+<part id="0"/>
+</presentation>
+</folder>
+</info>
+</mainWindow>
+</layout>
+</perspective>
+</perspectives>
+<workingSets/>
+<navigationHistory>
+<editors>
+<editor factoryID="org.eclipse.ui.part.FileEditorInputFactory" id="org.eclipse.ui.DefaultTextEditor" path="/Genetegrate/middleware/Simple.conf"/>
+<editor factoryID="org.eclipse.ui.part.FileEditorInputFactory" id="org.eclipse.ui.DefaultTextEditor" path="/Genetegrate/services/Servers.xml"/>
+<editor factoryID="org.eclipse.ui.part.FileEditorInputFactory" id="org.eclipse.ui.DefaultTextEditor" path="/Genetegrate/gaia_versions/Servers.xml"/>
+<editor factoryID="org.eclipse.ui.part.FileEditorInputFactory" id="org.eclipse.ui.DefaultTextEditor" path="/Genetegrate/gaia_versions/Simple.conf"/>
+<editor factoryID="org.eclipse.ui.part.FileEditorInputFactory" id="org.eclipse.ui.DefaultTextEditor" path="/Genetegrate/ClientCopy0.blastpgp"/>
+<editor factoryID="org.eclipse.ui.part.FileEditorInputFactory" id="org.eclipse.ui.DefaultTextEditor" path="/Genetegrate/ClientCopy3.blastpgp"/>
+<editor factoryID="org.eclipse.ui.part.FileEditorInputFactory" id="org.eclipse.ui.DefaultTextEditor" path="/Genetegrate/ClientCopy2.blastpgp"/>
+<editor factoryID="org.eclipse.ui.part.FileEditorInputFactory" id="org.eclipse.ui.DefaultTextEditor" path="/Genetegrate/ClientCopy1.blastpgp"/>
+</editors>
+<item historyLabel="Simple.conf" index="0">
+<position/>
+</item>
+<item historyLabel="Servers.xml" index="1">
+<position/>
+</item>
+<item historyLabel="Simple.conf" index="0">
+<position info="not_deleted" x="5" y="0"/>
+</item>
+<item historyLabel="Servers.xml" index="1">
+<position/>
+</item>
+<item historyLabel="Servers.xml" index="2">
+<position/>
+</item>
+<item historyLabel="Simple.conf" index="3">
+<position/>
+</item>
+<item historyLabel="Servers.xml" index="2">
+<position/>
+</item>
+<item historyLabel="Servers.xml" index="1">
+<position/>
+</item>
+<item historyLabel="Simple.conf" index="0">
+<position info="not_deleted" x="5" y="0"/>
+</item>
+<item historyLabel="Servers.xml" index="1">
+<position/>
+</item>
+<item historyLabel="ClientCopy0.blastpgp" index="4">
+<position/>
+</item>
+<item historyLabel="ClientCopy3.blastpgp" index="5">
+<position/>
+</item>
+<item historyLabel="ClientCopy2.blastpgp" index="6">
+<position/>
+</item>
+<item historyLabel="ClientCopy1.blastpgp" index="7">
+<position/>
+</item>
+<item historyLabel="ClientCopy0.blastpgp" index="4">
+<position/>
+</item>
+<item historyLabel="Servers.xml" index="1">
+<position info="not_deleted" x="182" y="0"/>
+</item>
+<item active="true" historyLabel="ClientCopy0.blastpgp" index="4">
+<position/>
+</item>
+</navigationHistory>
+<stickyState/>
+<input factoryID="org.eclipse.ui.internal.model.ResourceFactory" path="/" type="8"/>
+</page>
+<workbenchWindowAdvisor/>
+<actionBarAdvisor/>
+<trimLayout>
+<trimArea IMemento.internal.id="128">
+<trimItem IMemento.internal.id="org.eclipse.ui.internal.WorkbenchWindow.topBar"/>
+</trimArea>
+<trimArea IMemento.internal.id="1024">
+<trimItem IMemento.internal.id="org.eclise.ui.internal.FastViewBar"/>
+<trimItem IMemento.internal.id="org.eclipse.jface.action.StatusLineManager"/>
+<trimItem IMemento.internal.id="org.eclipse.ui.internal.progress.ProgressRegion"/>
+<trimItem IMemento.internal.id="org.eclipse.ui.internal.intro.impl.presentations.IntroLaunchBar"/>
+</trimArea>
+</trimLayout>
+</window>
+<mruList>
+<file factoryID="org.eclipse.ui.part.FileEditorInputFactory" id="org.eclipse.ui.DefaultTextEditor" name="ClientCopy4.blastpgp" tooltip="Genetegrate/ClientCopy4.blastpgp">
+<persistable path="/Genetegrate/ClientCopy4.blastpgp"/>
+</file>
+<file factoryID="org.eclipse.ui.part.FileEditorInputFactory" id="org.eclipse.ui.DefaultTextEditor" name="ClientCopy3.blastpgp" tooltip="Genetegrate/ClientCopy3.blastpgp">
+<persistable path="/Genetegrate/ClientCopy3.blastpgp"/>
+</file>
+<file factoryID="org.eclipse.ui.part.FileEditorInputFactory" id="org.eclipse.ui.DefaultTextEditor" name="ClientCopy2.blastpgp" tooltip="Genetegrate/ClientCopy2.blastpgp">
+<persistable path="/Genetegrate/ClientCopy2.blastpgp"/>
+</file>
+<file factoryID="org.eclipse.ui.part.FileEditorInputFactory" id="org.eclipse.ui.DefaultTextEditor" name="ClientCopy1.blastpgp" tooltip="Genetegrate/ClientCopy1.blastpgp">
+<persistable path="/Genetegrate/ClientCopy1.blastpgp"/>
+</file>
+<file factoryID="org.eclipse.ui.part.FileEditorInputFactory" id="org.eclipse.ui.DefaultTextEditor" name="ClientCopy0.blastpgp" tooltip="Genetegrate/ClientCopy0.blastpgp">
+<persistable path="/Genetegrate/ClientCopy0.blastpgp"/>
+</file>
+<file factoryID="org.eclipse.ui.part.FileEditorInputFactory" id="org.eclipse.ui.DefaultTextEditor" name="Servers.xml" tooltip="Genetegrate/services/Servers.xml">
+<persistable path="/Genetegrate/services/Servers.xml"/>
+</file>
+<file factoryID="org.eclipse.ui.part.FileEditorInputFactory" id="org.eclipse.ui.DefaultTextEditor" name="Simple.conf" tooltip="Genetegrate/gaia_versions/Simple.conf">
+<persistable path="/Genetegrate/gaia_versions/Simple.conf"/>
+</file>
+<file factoryID="org.eclipse.ui.part.FileEditorInputFactory" id="org.eclipse.ui.DefaultTextEditor" name="Servers.xml" tooltip="Genetegrate/gaia_versions/Servers.xml">
+<persistable path="/Genetegrate/gaia_versions/Servers.xml"/>
+</file>
+<file factoryID="org.eclipse.ui.part.FileEditorInputFactory" id="org.eclipse.ui.DefaultTextEditor" name="Simple.conf" tooltip="Genetegrate/middleware/Simple.conf">
+<persistable path="/Genetegrate/middleware/Simple.conf"/>
+</file>
+</mruList>
+</workbench>
\ No newline at end of file
diff --git a/geneWKspace/.metadata/.plugins/org.eclipse.ui.workbench/workingsets.xml b/geneWKspace/.metadata/.plugins/org.eclipse.ui.workbench/workingsets.xml
new file mode 100644
index 0000000..1fd7b94
--- /dev/null
+++ b/geneWKspace/.metadata/.plugins/org.eclipse.ui.workbench/workingsets.xml
@@ -0,0 +1,4 @@
+<?xml version="1.0" encoding="UTF-8"?>
+<workingSetManager>
+<workingSet aggregate="true" factoryID="org.eclipse.ui.internal.WorkingSetFactory" label="Window Working Set" name="Aggregate for window 1178822662468"/>
+</workingSetManager>
\ No newline at end of file
diff --git a/geneWKspace/.metadata/version.ini b/geneWKspace/.metadata/version.ini
new file mode 100644
index 0000000..c51ff74
--- /dev/null
+++ b/geneWKspace/.metadata/version.ini
@@ -0,0 +1 @@
+org.eclipse.core.runtime=1
\ No newline at end of file
diff --git a/geneWKspace/Genetegrate/.classpath b/geneWKspace/Genetegrate/.classpath
new file mode 100644
index 0000000..233be1d
--- /dev/null
+++ b/geneWKspace/Genetegrate/.classpath
@@ -0,0 +1,6 @@
+<?xml version="1.0" encoding="UTF-8"?>
+<classpath>
+	<classpathentry kind="src" path=""/>
+	<classpathentry kind="con" path="org.eclipse.jdt.launching.JRE_CONTAINER"/>
+	<classpathentry kind="output" path=""/>
+</classpath>
diff --git a/geneWKspace/Genetegrate/.project b/geneWKspace/Genetegrate/.project
new file mode 100644
index 0000000..8721d78
--- /dev/null
+++ b/geneWKspace/Genetegrate/.project
@@ -0,0 +1,17 @@
+<?xml version="1.0" encoding="UTF-8"?>
+<projectDescription>
+	<name>Genetegrate</name>
+	<comment></comment>
+	<projects>
+	</projects>
+	<buildSpec>
+		<buildCommand>
+			<name>org.eclipse.jdt.core.javabuilder</name>
+			<arguments>
+			</arguments>
+		</buildCommand>
+	</buildSpec>
+	<natures>
+		<nature>org.eclipse.jdt.core.javanature</nature>
+	</natures>
+</projectDescription>
diff --git a/geneWKspace/Genetegrate/ClientCopy0.blastpgp b/geneWKspace/Genetegrate/ClientCopy0.blastpgp
new file mode 100644
index 0000000..1827149
--- /dev/null
+++ b/geneWKspace/Genetegrate/ClientCopy0.blastpgp
@@ -0,0 +1,4737 @@
+BLASTP 2.2.15 [Oct-15-2006]
+
+
+Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
+Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
+"Gapped BLAST and PSI-BLAST: a new generation of protein database search
+programs",  Nucleic Acids Res. 25:3389-3402.
+
+Query= 1tof_
+         (111 letters)
+
+Database: All non-redundant GenBank CDS
+translations+PDB+SwissProt+PIR+PRF excluding environmental samples
+from WGS projects
+           4,904,269 sequences; 1,693,139,330 total letters
+
+
+
+                                                                 Score    E
+Sequences producing significant alignments:                      (bits) Value
+
+sp|P80028|TRXH_CHLRE Thioredoxin H-type (TRX-H) (Thioredoxin CH1...   196   2e-049
+pdb|1TOF|  Chain  , Thioredoxin H (Oxidized Form), Nmr, 23 Struc...   196   2e-049
+pdb|1EP8|A Chain A, Crystal Structure Of A Mutated Thioredoxin, ...   193   2e-048
+gb|AAU93947.1| thioredoxin H [Helicosporidium sp. ex Simulium jo...   108   6e-023
+gb|AAK72483.1| thioredoxin [Branchiostoma belcheri]                   100   3e-020
+emb|CAI64401.1| thioredoxin h2 protein [Zea mays]                      95   1e-018
+gb|AAM67018.1| thioredoxin [Arabidopsis thaliana]                      94   2e-018
+emb|CAA84610.1| thioredoxin [Arabidopsis thaliana]                     94   3e-018
+ref|NP_173403.1| ATTRX4 (thioredoxin H-type 4); thiol-disulfide ...    94   3e-018
+pdb|1WMJ|A Chain A, Solution Structure Of Thioredoxin Type H Fro...    93   4e-018
+ref|NP_001059069.1| Os07g0186000 [Oryza sativa (japonica cultiva...    93   4e-018
+gb|AAS19462.1| thioredoxin [Paxillus involutus]                        93   5e-018
+emb|CAC42084.1| thioredoxin h [Pisum sativum]                          91   1e-017
+gb|AAL26915.1|AF323593_1 thioredoxin H [Prunus persica]                91   1e-017
+gb|AAO12854.1| thioredoxin h [Pisum sativum]                           91   1e-017
+gb|AAL99941.1| thioredoxin H [Populus tremula x Populus tremuloi...    91   2e-017
+pdb|1TI3|A Chain A, Solution Structure Of The Thioredoxin H1 Fro...    91   2e-017
+ref|XP_001419941.1| predicted protein [Ostreococcus lucimarinus ...    90   3e-017
+gb|AAQ23135.1| thioredoxin H3 [Ipomoea batatas]                        90   3e-017
+sp|Q39362|TRXH2_BRANA Thioredoxin H-type 2 (TRX-H-2) >gi|1403711...    90   3e-017
+gb|AAC49355.1| thioredoxin h                                           89   9e-017
+gb|ABB53600.1| thioredoxin h [Eucalyptus grandis]                      88   1e-016
+ref|NP_001002461.1| hypothetical protein LOC436734 [Danio rerio]...    88   1e-016
+pdb|1XFL|A Chain A, Solution Structure Of Thioredoxin H1 From Ar...    88   1e-016
+ref|NP_190672.1| ATTRX1 (Arabidopsis thaliana thioredoxin H-type...    88   1e-016
+emb|CAG05766.1| unnamed protein product [Tetraodon nigroviridis]       87   2e-016
+ref|NP_956317.1| hypothetical protein LOC336637 [Danio rerio] >g...    87   3e-016
+gb|AAL67139.1| thioredoxin H [Triticum aestivum]                       86   4e-016
+ref|NP_491127.1| Y54E10A.3 [Caenorhabditis elegans] >gi|7672775|...    86   4e-016
+gb|AAZ98842.1| thioredoxin h1 [Medicago truncatula]                    86   6e-016
+emb|CAE54120.1| thioredoxin-1 [Mesobuthus cyprius] >gi|51869025|...    86   8e-016
+gb|AAR83852.1| thioredoxin [Capsicum annuum] >gi|125489263|gb|AB...    86   8e-016
+emb|CAE68992.1| Hypothetical protein CBG14979 [Caenorhabditis br...    86   8e-016
+pdb|2J23|A Chain A, Cross-Reactivity And Crystal Structure Of Ma...    85   1e-015
+gb|AAZ32865.1| thioredoxin h [Medicago sativa]                         85   1e-015
+sp|Q07090|TRXH2_TOBAC Thioredoxin H-type 2 (TRX-H2) >gi|297519|e...    85   1e-015
+emb|CAI78451.1| thioredoxin [Malassezia sympodialis]                   84   2e-015
+emb|CAE54169.1| thioredoxin-1 [Mesobuthus gibbosus]                    84   2e-015
+emb|CAE54129.1| thioredoxin-1 [Mesobuthus gibbosus]                    84   2e-015
+emb|CAE54152.1| thioredoxin-1 [Mesobuthus gibbosus] >gi|51869087...    84   2e-015
+emb|CAE54157.1| thioredoxin-1 [Mesobuthus gibbosus]                    84   2e-015
+emb|CAE54127.1| thioredoxin-1 [Mesobuthus gibbosus] >gi|51869037...    84   2e-015
+emb|CAE54137.1| thioredoxin-1 [Mesobuthus gibbosus] >gi|51869065...    84   2e-015
+gb|AAP72290.1| thioredoxin h isoform 1; HvTrxh1 [Hordeum vulgare...    84   2e-015
+ref|XP_001348719.1| thioredoxin [Plasmodium falciparum 3D7] >gi|...    84   2e-015
+pdb|1SYR|A Chain A, Initial Structural Analysis Of Plasmodium Fa...    84   2e-015
+sp|Q9UW02|THIO_COPCM Thioredoxin (Allergen Cop c 2) >gi|5689669|...    84   2e-015
+emb|CAE54136.1| thioredoxin-1 [Mesobuthus gibbosus]                    84   2e-015
+gb|AAZ98843.1| thioredoxin h2 [Medicago truncatula]                    84   3e-015
+sp|Q43636|TRXH_RICCO Thioredoxin H-type (TRX-H) >gi|1255954|emb|...    84   3e-015
+gb|ABN07937.1| Thioredoxin domain 2; Thioredoxin fold [Medicago ...    83   4e-015
+gb|ABL67654.1| putative H-type thioredoxin [Citrus cv. Shiranuhi]      83   4e-015
+ref|NP_500036.2| Y55F3AR.2 [Caenorhabditis elegans] >gi|31746584...    83   4e-015
+gb|AAP33009.1| thioredoxin H [Citrus x paradisi]                       83   4e-015
+emb|CAG05767.1| unnamed protein product [Tetraodon nigroviridis]       83   4e-015
+sp|Q9DGI3|THIO_ICTPU Thioredoxin (Trx) >gi|9837585|gb|AAG00612.1...    83   4e-015
+gb|EAU92470.1| hypothetical protein CC1G_00689 [Coprinopsis cine...    83   5e-015
+sp|P29449|TRXH1_TOBAC Thioredoxin H-type 1 (TRX-H1) >gi|20047|em...    83   5e-015
+emb|CAC36986.1| thioredoxin h [Pisum sativum]                          82   8e-015
+gb|ABD62163.1| thioredoxin [Schistosoma japonicum]                     82   8e-015
+gb|ABD65296.1| thioredoxin [Solanum berthaultii]                       82   1e-014
+gb|AAF66635.1|AF143404_1 thioredoxin-like protein TXL [Drosophil...    81   1e-014
+ref|NP_523938.2| Thioredoxin-like CG5495-PA [Drosophila melanoga...    81   1e-014
+emb|CAH59452.1| thioredoxin 3 [Plantago major]                         81   1e-014
+dbj|BAB25256.1| unnamed protein product [Mus musculus]                 81   1e-014
+ref|XP_734809.1| thioredoxin [Plasmodium chabaudi chabaudi] >gi|...    81   2e-014
+ref|NP_035790.1| thioredoxin 1 [Mus musculus] >gi|549078|sp|P106...    81   2e-014
+ref|XP_724442.1| thioredoxin [Plasmodium yoelii yoelii str. 17XN...    81   2e-014
+ref|NP_001055996.1| Os05g0508500 [Oryza sativa (japonica cultiva...    80   2e-014
+gb|AAD52699.1|AF091538_1 thioredoxin [Schistosoma japonicum]           80   2e-014
+gb|AAN63619.1|AF435818_1 thioredoxin h-like protein [Nicotiana t...    80   2e-014
+ref|NP_001075282.1| thioredoxin [Equus caballus] >gi|20140452|sp...    80   2e-014
+dbj|BAB20886.1| thioredoxin h [Oryza sativa (japonica cultivar-g...    80   2e-014
+gb|AAF34541.1|AF202664_1 thioredoxin 1 [Plasmodium falciparum]         80   3e-014
+ref|NP_446252.1| thioredoxin [Rattus norvegicus] >gi|135776|sp|P...    80   3e-014
+gb|EAT39951.1| conserved hypothetical protein [Aedes aegypti]          80   4e-014
+gb|AAY42864.1| thioredoxin H [Nicotiana alata]                         80   4e-014
+ref|XP_676088.1| thioredoxin [Plasmodium berghei strain ANKA] >g...    80   4e-014
+sp|O65049|TRXH_PICMA Thioredoxin H-type (TRX-H) >gi|2982247|gb|A...    80   4e-014
+gb|AAH72884.1| MGC80314 protein [Xenopus laevis]                       79   5e-014
+gb|AAN76509.1|AF352030_1 thioredoxin h [Brassica rapa]                 79   5e-014
+emb|CAE63862.1| Hypothetical protein CBG08424 [Caenorhabditis br...    79   5e-014
+sp|O64394|TRXH_WHEAT Thioredoxin H-type (TRX-H) (TrxTa) >gi|2995...    79   5e-014
+gb|AAL24517.1|AF420472_1 thioredoxin H [Triticum aestivum] >gi|2...    79   5e-014
+gb|EAZ10692.1| hypothetical protein OsJ_000517 [Oryza sativa (ja...    79   7e-014
+gb|AAN63617.1|AF435816_1 thioredoxin h-like protein [Zea mays]         79   7e-014
+ref|NP_001042127.1| Os01g0168200 [Oryza sativa (japonica cultiva...    79   7e-014
+ref|XP_001353864.1| GA18927-PA [Drosophila pseudoobscura] >gi|54...    79   7e-014
+gb|EAY72690.1| hypothetical protein OsI_000537 [Oryza sativa (in...    79   9e-014
+emb|CAB96931.1| thioredoxin h [Triticum aestivum] >gi|9502274|gb...    79   9e-014
+gb|AAD49233.1|AF159388_1 thioredoxin-like protein [Phalaris coer...    79   9e-014
+pir||S49353 protein S2 - Phalaris coerulescens                         79   9e-014
+pir||S49352 protein S1 - Phalaris coerulescens                         79   9e-014
+ref|XP_315465.2| ENSANGP00000014263 [Anopheles gambiae str. PEST...    79   9e-014
+gb|AAI29795.1| Unknown (protein for MGC:160515) [Xenopus laevis]       78   1e-013
+gb|AAD49230.1|AF159385_1 thioredoxin-like protein [Hordeum bulbo...    78   1e-013
+gb|AAP72291.1| thioredoxin h isoform 2; HvTrxh2 [Hordeum vulgare...    78   1e-013
+ref|XP_001353205.1| GA12311-PA [Drosophila pseudoobscura] >gi|54...    78   1e-013
+ref|XP_001398799.1| hypothetical protein An18g03380 [Aspergillus...    78   2e-013
+gb|AAL79841.1|AF473536_1 thioredoxin [Schistosoma mansoni]             78   2e-013
+gb|AAO12855.1| thioredoxin h [Pisum sativum]                           78   2e-013
+gb|AAG35777.1|AF273844_1 thioredoxin-h-like protein 1 [Brassica ...    78   2e-013
+sp|O64432|TRXH_BRARA Thioredoxin H-type (TRX-H) >gi|3062793|dbj|...    78   2e-013
+sp|P68176|TRXH_BRAOL Thioredoxin H-type (TRX-H) (Pollen coat pro...    78   2e-013
+ref|XP_001083928.1| PREDICTED: thioredoxin [Macaca mulatta]            77   2e-013
+ref|XP_001113950.1| PREDICTED: thioredoxin [Macaca mulatta]            77   2e-013
+gb|AAB01771.1| thioredoxin homolog                                     77   2e-013
+ref|NP_001036197.1| thioredoxin [Macaca mulatta] >gi|267126|sp|P...    77   2e-013
+ref|NP_593852.1| hypothetical protein SPAC7D4.07c [Schizosacchar...    77   2e-013
+gb|AAD49232.1|AF159387_1 thioredoxin-like protein [Lolium perenne]     77   3e-013
+ref|NP_001009421.1| thioredoxin [Ovis aries] >gi|1729950|sp|P504...    77   3e-013
+ref|XP_747097.1| thioredoxin, putative [Aspergillus fumigatus Af...    77   3e-013
+gb|AAN63616.1|AF435815_1 thioredoxin h-like protein [Hordeum vul...    77   4e-013
+gb|AAO16555.1| thioredoxin h [Leymus chinensis]                        77   4e-013
+ref|NP_187483.1| ATH9 (thioredoxin H-type 9); thiol-disulfide ex...    77   4e-013
+dbj|BAE56042.1| unnamed protein product [Aspergillus oryzae]           77   4e-013
+ref|NP_776393.1| thioredoxin [Bos taurus] >gi|13633977|sp|O97680...    77   4e-013
+sp|Q9BDJ3|THIO_CALJA Thioredoxin (Trx) >gi|13560979|gb|AAK30295....    77   4e-013
+ref|NP_999478.1| thioredoxin [Sus scrofa] >gi|20141821|sp|P82460...    77   4e-013
+pdb|1ERV|  Chain  , Human Thioredoxin Mutant With Cys 73 Replace...    77   4e-013
+ref|XP_760726.1| hypothetical protein UM04579.1 [Ustilago maydis...    77   4e-013
+pdb|2HXK|A Chain A, Crystal Structure Of S-Nitroso Thioredoxin >...    76   5e-013
+pdb|2IFQ|A Chain A, Crystal Structure Of S-Nitroso Thioredoxin >...    76   5e-013
+ref|XP_001142154.1| PREDICTED: similar to Thioredoxin (ATL-deriv...    76   5e-013
+gb|AAP36296.1| Homo sapiens thioredoxin [synthetic construct] >g...    76   5e-013
+ref|NP_003320.2| thioredoxin [Homo sapiens] >gi|135773|sp|P10599...    76   5e-013
+pdb|1AIU|  Chain  , Human Thioredoxin (D60n Mutant, Reduced Form)      76   5e-013
+ref|NP_001078175.1| ATTDX (TETRATICOPEPTIDE DOMAIN-CONTAINING TH...    76   6e-013
+gb|ABO83980.1| Thioredoxin domain 2; Thioredoxin fold [Medicago ...    76   6e-013
+ref|XP_001261730.1| thioredoxin, putative [Neosartorya fischeri ...    76   6e-013
+gb|ABC75102.1| thioredoxin [Cryphonectria parasitica]                  76   6e-013
+gb|AAP88338.1| At3g17880 [Arabidopsis thaliana]                        76   6e-013
+gb|AAD49231.1|AF159386_1 thioredoxin-like protein [Secale cereale]     76   6e-013
+emb|CAH59450.1| thioredoxin 1 [Plantago major]                         76   6e-013
+sp|Q6XHI1|THIO2_DROYA Thioredoxin-2 >gi|38048645|gb|AAR10225.1| ...    76   6e-013
+ref|NP_188415.2| ATTDX (TETRATICOPEPTIDE DOMAIN-CONTAINING THIOR...    76   6e-013
+ref|XP_001135716.1| PREDICTED: thioredoxin domain-containing 2 i...    75   8e-013
+ref|XP_001135635.1| PREDICTED: thioredoxin domain-containing 2 i...    75   8e-013
+ref|XP_974503.1| PREDICTED: similar to CG5495-PA [Tribolium cast...    75   8e-013
+ref|NP_001054758.1| Os05g0169000 [Oryza sativa (japonica cultiva...    75   8e-013
+emb|CAG25528.1| thioredoxin [Suberites ficus]                          75   8e-013
+gb|AAF05765.1|AF192765_1 thioredoxin [Schizosaccharomyces pombe]       75   8e-013
+gb|AAN63618.1|AF435817_1 thioredoxin h-like protein [Oryza sativa]     75   8e-013
+pdb|1XWA|A Chain A, Drospohila Thioredoxin, Oxidized, P41212 >gi...    75   8e-013
+ref|NP_523526.1| thioredoxin-2 CG31884-PA, isoform A [Drosophila...    75   8e-013
+pdb|1TRS|  Chain  , Thioredoxin Mutant With Cys 62 Replaced By A...    75   8e-013
+gb|EAY98638.1| hypothetical protein OsI_019871 [Oryza sativa (in...    75   1e-012
+emb|CAI64400.1| thioredoxin h1 protein [Zea mays]                      75   1e-012
+dbj|BAE63675.1| unnamed protein product [Aspergillus oryzae]           75   1e-012
+ref|XP_390593.1| hypothetical protein FG10417.1 [Gibberella zeae...    75   1e-012
+gb|ABL67652.1| putative thioredoxin H protein [Citrus cv. Shiran...    75   1e-012
+gb|AAO20259.1| thioredoxin o [Chlamydomonas reinhardtii]               75   1e-012
+gb|AAM66084.1| thioredoxin [Arabidopsis thaliana]                      75   1e-012
+gb|AAC49356.1| thioredoxin h                                           75   1e-012
+gb|AAC49353.1| thioredoxin h                                           75   1e-012
+gb|AAS88427.1| thioredoxin [Glycine max]                               75   1e-012
+ref|NP_198811.1| ATTRX2 (Arabidopsis thioredoxin h2, thioredoxin...    75   1e-012
+ref|NP_175128.1| ATTRX5 (thioredoxin H-type 5); thiol-disulfide ...    75   1e-012
+pdb|2IWT|A Chain A, Thioredoxin H2 (Hvtrxh2) In A Mixed Disulfid...    74   2e-012
+ref|ZP_01272767.1| Thioredoxin [Psychrobacter sp. PRwf-1] >gi|91...    74   2e-012
+ref|XP_454686.1| unnamed protein product [Kluyveromyces lactis] ...    74   2e-012
+gb|AAD56954.1|AF186240_1 thioredoxin-like protein [Secale cereale]     74   2e-012
+ref|ZP_00946733.1| Thioredoxin [Ralstonia solanacearum UW551] >g...    74   2e-012
+gb|ABJ97191.1| thioredoxin-like protein [Bombyx mori] >gi|124127...    74   2e-012
+emb|CAL57894.1| MGC80314 protein (ISS) [Ostreococcus tauri]            74   2e-012
+emb|CAJ20392.1| thioredoxin, putative [Toxoplasma gondii RH]           74   2e-012
+gb|AAM60989.1| tetratricoredoxin [Arabidopsis thaliana]                74   2e-012
+gb|AAK64512.1| Hsp70 interacting protein/thioredoxin chimera [Vi...    74   2e-012
+dbj|BAC05133.1| unnamed protein product [Homo sapiens]                 74   2e-012
+ref|NP_990784.1| thioredoxin [Gallus gallus] >gi|135767|sp|P0862...    74   2e-012
+pdb|3TRX|  Chain  , Thioredoxin (Reduced Form) >gi|231098|pdb|4T...    74   2e-012
+ref|XP_643331.1| ZZ type Zn finger-containing protein [Dictyoste...    74   2e-012
+gb|EAX01594.1| thioredoxin domain containing 2 (spermatozoa), is...    74   3e-012
+sp|Q86VQ3|TXND2_HUMAN Thioredoxin domain-containing protein 2 (S...    74   3e-012
+ref|XP_950855.1| PREDICTED: similar to thioredoxin domain-contai...    74   3e-012
+ref|XP_947255.1| PREDICTED: similar to Thioredoxin domain-contai...    74   3e-012
+gb|AAH50132.1| Thioredoxin domain containing 2 (spermatozoa) [Ho...    74   3e-012
+ref|XP_532029.2| PREDICTED: similar to Thioredoxin (ATL-derived ...    74   3e-012
+gb|AAF86466.1|AF276919_1 thioredoxin 1 [Homo sapiens] >gi|339649...    74   3e-012
+ref|NP_115619.4| thioredoxin domain-containing 2 [Homo sapiens] ...    74   3e-012
+ref|NP_001059090.1| Os07g0190800 [Oryza sativa (japonica cultiva...    74   3e-012
+ref|NP_199112.1| ATTRX3 (thioredoxin H-type 3); thiol-disulfide ...    74   3e-012
+dbj|BAB02711.1| thioredoxin-like protein [Arabidopsis thaliana]        74   3e-012
+sp|Q8IFW4|THIOT_DROME Thioredoxin-T (ThioredoxinT) >gi|24940543|...    74   3e-012
+ref|XP_753517.1| thioredoxin TrxA [Aspergillus fumigatus Af293] ...    74   3e-012
+sp|P08628|THIO_RABIT Thioredoxin (Trx)                                 73   4e-012
+ref|XP_001417928.1| predicted protein [Ostreococcus lucimarinus ...    73   4e-012
+sp|Q96419|TRXH_FAGES Thioredoxin H-type (TRX-H) >gi|1620905|dbj|...    73   4e-012
+ref|YP_903030.1| thioredoxin [Pelobacter propionicus DSM 2379] >...    73   4e-012
+ref|XP_001422018.1| predicted protein [Ostreococcus lucimarinus ...    73   5e-012
+gb|ABN12051.1| putative thioredoxin-like protein [Maconellicoccu...    73   5e-012
+ref|ZP_01529583.1| thioredoxin [Roseiflexus castenholzii DSM 139...    73   5e-012
+gb|AAK70900.1|AF394233_1 thioredoxin [Aedes aegypti] >gi|1088729...    73   5e-012
+gb|AAO72714.1| thioredoxin 1 [Melopsittacus undulatus]                 73   5e-012
+gb|AAN63622.1|AF438359_1 thioredoxin [Triticum aestivum]               73   5e-012
+gb|AAV73827.1| thioredoxin [Chlamys farreri]                           73   5e-012
+ref|NP_070112.1| thioredoxin (trx-3) [Archaeoglobus fulgidus DSM...    73   5e-012
+dbj|BAE56663.1| unnamed protein product [Aspergillus oryzae]           73   5e-012
+sp|Q9V429|THIO2_DROME Thioredoxin-2 (DmTrx-2) >gi|16648464|gb|AA...    73   5e-012
+ref|NP_519309.1| PROBABLE THIOREDOXIN 1 (REDOX FACTOR) PROTEIN [...    73   5e-012
+sp|P34723|THIO_PENCH Thioredoxin >gi|426469|emb|CAA53726.1| thio...    73   5e-012
+ref|ZP_00109755.1| COG0526: Thiol-disulfide isomerase and thiore...    73   5e-012
+ref|XP_001374573.1| PREDICTED: similar to thioredoxin [Monodelph...    72   7e-012
+gb|ABM54166.1| thioredoxin [Brassica juncea]                           72   7e-012
+ref|ZP_01662550.1| putative thioredoxin 1 (redox factor) protein...    72   7e-012
+gb|AAV63537.1| fed tick salivary protein 3 [Ixodes scapularis]         72   7e-012
+ref|NP_001051587.1| Os03g0800700 [Oryza sativa (japonica cultiva...    72   7e-012
+ref|YP_291885.1| thioredoxin [Prochlorococcus marinus str. NATL2...    72   7e-012
+ref|NP_648717.1| CG13473-PA [Drosophila melanogaster] >gi|729436...    72   7e-012
+ref|NP_572212.1| Thioredoxin T CG3315-PA [Drosophila melanogaste...    72   7e-012
+ref|NP_893178.1| Thioredoxin [Prochlorococcus marinus subsp. pas...    72   7e-012
+ref|YP_001011465.1| Thioredoxin [Prochlorococcus marinus str. MI...    72   9e-012
+ref|XP_001216347.1| thioredoxin [Aspergillus terreus NIH2624] >g...    72   9e-012
+gb|AAO20258.1| cytosolic thioredoxin h2 [Chlamydomonas reinhardtii]    72   9e-012
+ref|YP_320708.1| Thioredoxin [Anabaena variabilis ATCC 29413] >g...    72   9e-012
+emb|CAB66676.2| hypothetical protein [Homo sapiens]                    72   9e-012
+ref|NP_681601.1| thioredoxin [Thermosynechococcus elongatus BP-1...    72   9e-012
+pdb|1MDI|A Chain A, High Resolution Solution Nmr Structure Of Mi...    72   9e-012
+ref|YP_397567.1| thioredoxin [Prochlorococcus marinus str. MIT 9...    72   1e-011
+ref|YP_265270.1| putative thioredoxin [Psychrobacter arcticus 27...    72   1e-011
+ref|NP_849585.1| ATHM1 (Arabidopsis thioredoxin M-type 1); thiol...    72   1e-011
+sp|Q5R9M3|THIO_PONPY Thioredoxin (Trx) >gi|55729616|emb|CAH91537...    72   1e-011
+ref|YP_001092469.1| thioredoxin [Shewanella loihica PV-4] >gi|12...    72   1e-011
+ref|YP_581553.1| thioredoxin [Psychrobacter cryohalolentis K5] >...    72   1e-011
+ref|ZP_00377914.1| COG0526: Thiol-disulfide isomerase and thiore...    72   1e-011
+ref|YP_001180505.1| thioredoxin [Caldicellulosiruptor saccharoly...    71   1e-011
+ref|ZP_01623378.1| thioredoxin [Lyngbya sp. PCC 8106] >gi|119453...    71   1e-011
+ref|XP_001274429.1| thioredoxin TrxA [Aspergillus clavatus NRRL ...    71   1e-011
+ref|YP_394376.1| Thioredoxin [Thiomicrospira denitrificans ATCC ...    71   1e-011
+gb|AAW27028.1| SJCHGC03599 protein [Schistosoma japonicum]             71   1e-011
+emb|CAE54118.1| thioredoxin-1 [Mesobuthus eupeus]                      71   1e-011
+sp|Q41864|TRXM_MAIZE Thioredoxin M-type, chloroplast precursor (...    71   1e-011
+gb|AAC49358.1| thioredoxin m                                           71   1e-011
+ref|YP_429787.1| thioredoxin [Moorella thermoacetica ATCC 39073]...    71   1e-011
+ref|NP_349683.1| Thioredoxin [Clostridium acetobutylicum ATCC 82...    71   1e-011
+sp|P48384|TRXM_PEA Thioredoxin M-type, chloroplast precursor (TR...    71   1e-011
+ref|ZP_01005152.1| Thioredoxin family protein [Prochlorococcus m...    71   1e-011
+ref|XP_381261.1| hypothetical protein FG01085.1 [Gibberella zeae...    71   1e-011
+ref|ZP_01594389.1| thioredoxin [Geobacter lovleyi SZ] >gi|118680...    71   2e-011
+ref|XP_001094289.1| PREDICTED: thioredoxin [Macaca mulatta]            71   2e-011
+ref|ZP_01289409.1| Thioredoxin [delta proteobacterium MLMS-1] >g...    71   2e-011
+dbj|BAE01341.1| unnamed protein product [Macaca fascicularis]          71   2e-011
+ref|XP_361762.1| conserved hypothetical protein [Magnaporthe gri...    71   2e-011
+sp|Q9XGS0|TRXM_BRANA Thioredoxin M-type, chloroplast precursor (...    71   2e-011
+sp|Q9ZP21|TRXM_WHEAT Thioredoxin M-type, chloroplast precursor (...    71   2e-011
+ref|XP_001356371.1| GA16546-PA [Drosophila pseudoobscura] >gi|54...    71   2e-011
+ref|XP_001355410.1| GA17324-PA [Drosophila pseudoobscura] >gi|54...    71   2e-011
+ref|YP_001099027.1| thioredoxin [Herminiimonas arsenicoxydans] >...    70   3e-011
+ref|ZP_01576361.1| thioredoxin [Clostridium cellulolyticum H10] ...    70   3e-011
+emb|CAL52715.1| thioredoxin (ISS) [Ostreococcus tauri]                 70   3e-011
+ref|YP_730183.1| thioredoxin [Synechococcus sp. CC9311] >gi|1138...    70   3e-011
+ref|YP_001046143.1| thioredoxin [Methanoculleus marisnigri JR1] ...    70   3e-011
+gb|AAQ84040.1| thioredoxin [Paracoccidioides brasiliensis]             70   3e-011
+gb|AAM67285.1| putative M-type thioredoxin [Arabidopsis thaliana]      70   3e-011
+ref|YP_301740.1| thioredoxin [Staphylococcus saprophyticus subsp...    70   3e-011
+ref|NP_889766.1| thioredoxin 1 [Bordetella bronchiseptica RB50] ...    70   3e-011
+ref|NP_192261.1| ATHM2 (Arabidopsis thioredoxin M-type 2); thiol...    70   3e-011
+ref|ZP_00907870.1| Thioredoxin [Clostridium beijerincki NCIMB 80...    70   3e-011
+ref|XP_762659.1| hypothetical protein UM06512.1 [Ustilago maydis...    70   3e-011
+ref|ZP_01551745.1| Thioredoxin [Methylophilales bacterium HTCC21...    70   3e-011
+emb|CAJ49989.1| thioredoxin 1 [Bordetella avium 197N]                  70   3e-011
+gb|AAQ23133.1| thioredoxin H2 [Ipomoea batatas]                        70   3e-011
+ref|NP_530737.1| thioredoxin C-1 [Agrobacterium tumefaciens str....    70   3e-011
+ref|NP_875531.1| Thioredoxin family protein [Prochlorococcus mar...    70   3e-011
+ref|NP_353062.1| hypothetical protein AGR_C_37 [Agrobacterium tu...    70   3e-011
+ref|ZP_01144483.1| thioredoxin [Acidiphilium cryptum JF-5] >gi|8...    70   3e-011
+ref|YP_615213.1| thioredoxin [Sphingopyxis alaskensis RB2256] >g...    70   3e-011
+ref|NP_371669.1| thioredoxin [Staphylococcus aureus subsp. aureu...    70   3e-011
+ref|XP_001259562.1| thioredoxin TrxA [Neosartorya fischeri NRRL ...    70   4e-011
+ref|ZP_01356345.1| thioredoxin [Roseiflexus sp. RS-1] >gi|106771...    70   4e-011
+gb|AAL77224.2| thioredoxin II [Podospora anserina]                     70   4e-011
+ref|YP_474239.1| thioredoxin [Synechococcus sp. JA-3-3Ab] >gi|86...    70   4e-011
+ref|XP_547674.2| PREDICTED: similar to Thioredoxin domain contai...    70   4e-011
+dbj|BAE16559.1| thioredoxin h [Codonopsis lanceolata]                  70   4e-011
+sp|Q5WNE3|NGLY1_CAEBR Peptide-N(4)-(N-acetyl-beta-glucosaminyl)a...    70   4e-011
+ref|NP_486407.1| thioredoxin [Nostoc sp. PCC 7120] >gi|17131459|...    70   4e-011
+sp|Q98TX1|THIO_OPHHA Thioredoxin (Trx) >gi|12958636|gb|AAK09384....    70   4e-011
+ref|XP_719372.1| putative thioredoxin [Candida albicans SC5314] ...    70   4e-011
+ref|XP_389623.1| hypothetical protein FG09447.1 [Gibberella zeae...    70   4e-011
+gb|ABD98743.1| thioredoxin-like protein [Graphocephala atropunct...    69   6e-011
+ref|ZP_01222208.1| putative thioredoxin [Photobacterium profundu...    69   6e-011
+gb|AAT76629.1| thioredoxin 2 [Schistosoma mansoni]                     69   6e-011
+gb|AAF15949.1|AF095750_1 thioredoxin m2 [Arabidopsis thaliana]         69   6e-011
+ref|YP_276627.1| thioredoxin, putative [Pseudomonas syringae pv....    69   6e-011
+ref|XP_392963.1| PREDICTED: similar to thioredoxin-2 CG31884-PA,...    69   6e-011
+gb|AAD33596.1|AF133127_1 thioredoxin h [Hevea brasiliensis]            69   6e-011
+ref|YP_253731.1| thioredoxin [Staphylococcus haemolyticus JCSC14...    69   6e-011
+ref|YP_131614.1| putative thioredoxin [Photobacterium profundum ...    69   6e-011
+ref|NP_880034.1| thioredoxin 1 [Bordetella pertussis Tohama I] >...    69   6e-011
+ref|NP_764393.1| thioredoxin [Staphylococcus epidermidis ATCC 12...    69   6e-011
+ref|ZP_01124485.1| Thioredoxin [Synechococcus sp. WH 7805] >gi|8...    69   6e-011
+ref|YP_001169141.1| thioredoxin [Rhodobacter sphaeroides ATCC 17...    69   6e-011
+ref|ZP_00110673.1| COG0526: Thiol-disulfide isomerase and thiore...    69   6e-011
+ref|YP_001171368.1| thioredoxin [Pseudomonas stutzeri A1501] >gi...    69   7e-011
+ref|XP_001388687.1| hypothetical protein An01g02500 [Aspergillus...    69   7e-011
+gb|EAY82500.1| hypothetical protein OsI_036459 [Oryza sativa (in...    69   7e-011
+ref|ZP_01539492.1| thioredoxin [Shewanella woodyi ATCC 51908] >g...    69   7e-011
+ref|ZP_01515801.1| thioredoxin [Chloroflexus aggregans DSM 9485]...    69   7e-011
+dbj|BAE99119.1| thioredoxin m4 [Arabidopsis thaliana]                  69   7e-011
+ref|ZP_01367492.1| hypothetical protein PaerPA_01004644 [Pseudom...    69   7e-011
+ref|ZP_01296826.1| hypothetical protein PaerP_01001200 [Pseudomo...    69   7e-011
+ref|YP_358473.1| thioredoxin [Pelobacter carbinolicus DSM 2380] ...    69   7e-011
+gb|AAF15951.1|AF095752_1 thioredoxin m4 [Arabidopsis thaliana]         69   7e-011
+dbj|BAE60118.1| unnamed protein product [Aspergillus oryzae]           69   7e-011
+sp|Q9ZP20|TRXM_ORYSA Thioredoxin M-type, chloroplast precursor (...    69   7e-011
+ref|NP_188155.1| ATHM4 (Arabidopsis thioredoxin M-type 4); thiol...    69   7e-011
+dbj|BAC21264.1| thioredoxin h [Cucurbita maxima]                       69   7e-011
+ref|ZP_01143275.1| Thioredoxin [Geobacter uraniumreducens Rf4] >...    69   7e-011
+ref|ZP_00967542.1| COG3118: Thioredoxin domain-containing protei...    69   7e-011
+ref|ZP_00768601.1| Thioredoxin [Chloroflexus aurantiacus J-10-fl...    69   7e-011
+ref|YP_369367.1| Thioredoxin [Burkholderia sp. 383] >gi|84354841...    69   7e-011
+ref|YP_789059.1| putative thioredoxin [Pseudomonas aeruginosa UC...    69   7e-011
+ref|NP_252750.1| probable thioredoxin [Pseudomonas aeruginosa PA...    69   7e-011
+ref|XP_001268135.1| thioredoxin, putative [Aspergillus clavatus ...    69   1e-010
+gb|EAU92826.1| predicted protein [Coprinopsis cinerea okayama7#130]    69   1e-010
+ref|ZP_01470362.1| Thioredoxin [Synechococcus sp. RS9916] >gi|11...    69   1e-010
+ref|ZP_01413977.1| probable thioredoxin protein [Sinorhizobium m...    69   1e-010
+ref|ZP_01216810.1| putative thioredoxin [Psychromonas sp. CNPT3]...    69   1e-010
+ref|XP_623128.1| PREDICTED: similar to Thioredoxin-like CG5495-P...    69   1e-010
+ref|YP_064546.1| thioredoxin [Desulfotalea psychrophila LSv54] >...    69   1e-010
+sp|Q7M1B9|THIO_CHLAU Thioredoxin (TRX)                                 69   1e-010
+pdb|1ERW|  Chain  , Human Thioredoxin Double Mutant With Cys 32 ...    69   1e-010
+ref|ZP_01112943.1| thioredoxin [Reinekea sp. MED297] >gi|8878022...    69   1e-010
+ref|ZP_01080656.1| Thioredoxin [Synechococcus sp. RS9917] >gi|86...    69   1e-010
+ref|YP_584282.1| thioredoxin [Ralstonia metallidurans CH34] >gi|...    69   1e-010
+ref|XP_318603.3| ENSANGP00000004582 [Anopheles gambiae str. PEST...    69   1e-010
+ref|ZP_01715597.1| thioredoxin [Pseudomonas putida GB-1] >gi|126...    68   1e-010
+gb|EAZ44666.1| hypothetical protein OsJ_028149 [Oryza sativa (ja...    68   1e-010
+gb|EAZ23950.1| hypothetical protein OsJ_007433 [Oryza sativa (ja...    68   1e-010
+gb|EAZ09039.1| hypothetical protein OsI_030271 [Oryza sativa (in...    68   1e-010
+gb|EAY86842.1| hypothetical protein OsI_008075 [Oryza sativa (in...    68   1e-010
+ref|YP_001189340.1| thioredoxin [Pseudomonas mendocina ymp] >gi|...    68   1e-010
+ref|ZP_01465378.1| thioredoxin [Stigmatella aurantiaca DW4/3-1] ...    68   1e-010
+ref|ZP_01228494.1| thioredoxin [Aurantimonas sp. SI85-9A1] >gi|9...    68   1e-010
+emb|CAE54119.1| thioredoxin-1 [Mesobuthus caucasicus]                  68   1e-010
+ref|YP_476455.1| thioredoxin [Synechococcus sp. JA-2-3B'a(2-13)]...    68   1e-010
+gb|ABC46707.1| chloroplast thioredoxin M-type [Arachis hypogaea]       68   1e-010
+ref|YP_237534.1| Thioredoxin [Pseudomonas syringae pv. syringae ...    68   1e-010
+ref|NP_001063120.1| Os09g0401200 [Oryza sativa (japonica cultiva...    68   1e-010
+ref|NP_001047543.1| Os02g0639900 [Oryza sativa (japonica cultiva...    68   1e-010
+ref|NP_923826.1| thioredoxin [Gloeobacter violaceus PCC 7421] >g...    68   1e-010
+prf||2105155A thioredoxin                                              68   1e-010
+pdb|1M7T|A Chain A, Solution Structure And Dynamics Of The Human...    68   1e-010
+ref|ZP_00908603.1| Thioredoxin [Clostridium beijerincki NCIMB 80...    68   1e-010
+ref|ZP_01433367.1| thioredoxin [Shewanella baltica OS195] >gi|12...    68   1e-010
+ref|ZP_00511797.1| Thioredoxin [Chlorobium limicola DSM 245] >gi...    68   1e-010
+ref|YP_722889.1| thioredoxin [Trichodesmium erythraeum IMS101] >...    68   1e-010
+ref|ZP_00518225.1| Thioredoxin [Crocosphaera watsonii WH 8501] >...    68   1e-010
+ref|YP_676727.1| thioredoxin [Cytophaga hutchinsonii ATCC 33406]...    68   1e-010
+ref|XP_001390194.1| hypothetical protein An03g02980 [Aspergillus...    68   2e-010
+ref|YP_001089548.1| thioredoxin [Clostridium difficile 630] >gi|...    68   2e-010
+gb|AAO20261.1| thioredoxin f1 [Chlamydomonas reinhardtii]              68   2e-010
+ref|YP_524140.1| thioredoxin [Rhodoferax ferrireducens T118] >gi...    68   2e-010
+gb|AAF16695.1|AF117573_1 thioredoxin-like protein [Manduca sexta]      68   2e-010
+gb|AAL54858.1| tetratricoredoxin [Nicotiana tabacum]                   68   2e-010
+gb|AAK07845.1|AF309689_7 putative thioredoxin G6G8.7 [Neurospora...    68   2e-010
+ref|YP_462242.1| thioredoxin [Syntrophus aciditrophicus SB] >gi|...    68   2e-010
+ref|YP_375166.1| Thioredoxin [Pelodictyon luteolum DSM 273] >gi|...    68   2e-010
+ref|XP_787070.1| PREDICTED: similar to thioredoxin isoform 2 [St...    68   2e-010
+ref|YP_386168.1| Thioredoxin [Geobacter metallireducens GS-15] >...    68   2e-010
+dbj|BAE20189.1| thioredoxin [Brevibacillus choshinensis]               68   2e-010
+ref|ZP_01084964.1| Thioredoxin [Synechococcus sp. WH 5701] >gi|8...    68   2e-010
+ref|ZP_00996025.1| thioredoxin [Janibacter sp. HTCC2649] >gi|843...    68   2e-010
+ref|ZP_00992393.1| thioredoxin [Vibrio splendidus 12B01] >gi|843...    68   2e-010
+ref|ZP_00369338.1| thioredoxin [Campylobacter lari RM2100] >gi|5...    68   2e-010
+ref|XP_962263.1| thioredoxin [Neurospora crassa OR74A] ) >gi|289...    68   2e-010
+ref|ZP_01732379.1| thioredoxin [Cyanothece sp. CCY0110] >gi|1266...    67   2e-010
+ref|ZP_01731054.1| Thioredoxin [Cyanothece sp. CCY0110] >gi|1266...    67   2e-010
+pdb|2FA4|A Chain A, Crystal Structure Of Oxidized Form From Sacc...    67   2e-010
+ref|ZP_01641110.1| thioredoxin [Pseudomonas putida W619] >gi|119...    67   2e-010
+ref|ZP_01631420.1| Thioredoxin [Nodularia spumigena CCY9414] >gi...    67   2e-010
+ref|ZP_01531319.1| thioredoxin [Roseiflexus castenholzii DSM 139...    67   2e-010
+ref|ZP_01355837.1| thioredoxin [Roseiflexus sp. RS-1] >gi|106772...    67   2e-010
+gb|AAU82124.1| thioredoxin [uncultured archaeon GZfos10C7]             67   2e-010
+ref|YP_442739.1| thioredoxin [Burkholderia thailandensis E264] >...    67   2e-010
+ref|YP_333769.1| thioredoxin 1 [Burkholderia pseudomallei 1710b]...    67   2e-010
+ref|YP_296325.1| Thioredoxin [Ralstonia eutropha JMP134] >gi|113...    67   2e-010
+ref|NP_983273.1| ACL131Wp [Ashbya gossypii ATCC 10895] >gi|44981...    67   2e-010
+ref|NP_811142.1| thioredoxin (thioredoxin M) [Bacteroides thetai...    67   2e-010
+ref|XP_504863.1| hypothetical protein [Yarrowia lipolytica] >gi|...    67   2e-010
+ref|NP_931826.1| thioredoxin 1 (TRX1) (TRX) [Photorhabdus lumine...    67   2e-010
+ref|NP_011725.1| Cytoplasmic thioredoxin isoenzyme of the thiore...    67   2e-010
+ref|NP_442553.1| thioredoxin [Synechocystis sp. PCC 6803] >gi|17...    67   2e-010
+ref|NP_484096.1| thioredoxin [Nostoc sp. PCC 7120] >gi|75908866|...    67   2e-010
+prf||2006292A thioredoxin                                              67   2e-010
+ref|NP_384139.1| PROBABLE THIOREDOXIN PROTEIN [Sinorhizobium mel...    67   2e-010
+sp|P00275|THIO1_CORNE Thioredoxin C-1                                  67   2e-010
+ref|ZP_01135869.1| thioredoxin 1, redox factor [Pseudoalteromona...    67   2e-010
+ref|ZP_01101916.1| Thioredoxin domain-containing protein [gamma ...    67   2e-010
+ref|YP_982424.1| thioredoxin [Polaromonas naphthalenivorans CJ2]...    67   2e-010
+ref|YP_108117.1| thioredoxin 1 [Burkholderia pseudomallei K96243...    67   2e-010
+ref|YP_676116.1| thioredoxin [Mesorhizobium sp. BNC1] >gi|110286...    67   2e-010
+gb|ABQ17215.1| thioredoxin [Dehalococcoides sp. BAV1]                  67   3e-010
+ref|ZP_01721207.1| thioredoxin [Algoriphagus sp. PR1] >gi|126575...    67   3e-010
+gb|EAY55688.1| Thiol-disulfide isomerase [Leptospirillum sp. Gro...    67   3e-010
+gb|ABM55528.1| thioredoxin-like protein [Maconellicoccus hirsutus]     67   3e-010
+ref|ZP_01612498.1| thioredoxin 1, redox factor [Alteromonadales ...    67   3e-010
+ref|YP_944477.1| thioredoxin [Psychromonas ingrahamii 37] >gi|11...    67   3e-010
+ref|NP_001040348.1| thioredoxin [Bombyx mori] >gi|95102586|gb|AB...    67   3e-010
+gb|AAL90749.1| thioredoxin H [Populus tremula x Populus tremuloi...    67   3e-010
+ref|NP_595306.1| thioredoxin-like protein [Schizosaccharomyces p...    67   3e-010
+ref|YP_376732.1| Thioredoxin [Synechococcus sp. CC9902] >gi|1160...    67   3e-010
+ref|YP_266943.1| thioredoxin [Colwellia psychrerythraea 34H] >gi...    67   3e-010
+ref|YP_262594.1| thioredoxin, putative [Pseudomonas fluorescens ...    67   3e-010
+ref|YP_169062.1| thioredoxin [Silicibacter pomeroyi DSS-3] >gi|5...    67   3e-010
+ref|YP_307733.1| thioredoxin [Dehalococcoides sp. CBDB1] >gi|736...    67   3e-010
+ref|XP_504314.1| hypothetical protein [Yarrowia lipolytica] >gi|...    67   3e-010
+ref|ZP_01139133.1| Thioredoxin [Dehalococcoides sp. BAV1]              67   3e-010
+ref|YP_961911.1| thioredoxin [Shewanella sp. W3-18-1] >gi|124546...    67   3e-010
+ref|ZP_00418411.1| Thioredoxin [Azotobacter vinelandii AvOP] >gi...    67   3e-010
+ref|NP_716044.1| thioredoxin 1 [Shewanella oneidensis MR-1] >gi|...    67   3e-010
+ref|ZP_01675172.1| thioredoxin [Candidatus Desulfococcus oleovor...    67   4e-010
+ref|ZP_01311219.1| thioredoxin [Desulfuromonas acetoxidans DSM 6...    67   4e-010
+ref|YP_606342.1| thioredoxin [Pseudomonas entomophila L48] >gi|9...    67   4e-010
+ref|NP_825483.1| thioredoxin [Streptomyces avermitilis MA-4680] ...    67   4e-010
+gb|AAH84818.1| LOC495354 protein [Xenopus laevis]                      67   4e-010
+gb|AAF14217.1|AF107490_1 thioredoxin [Fasciola hepatica]               67   4e-010
+ref|YP_446755.1| thioredoxin [Salinibacter ruber DSM 13855] >gi|...    67   4e-010
+ref|YP_382241.1| thioredoxin [Synechococcus sp. CC9605] >gi|7819...    67   4e-010
+ref|YP_359411.1| thioredoxin [Carboxydothermus hydrogenoformans ...    67   4e-010
+ref|YP_097994.1| thioredoxin [Bacteroides fragilis YCH46] >gi|60...    67   4e-010
+ref|NP_896817.1| Thioredoxin [Synechococcus sp. WH 8102] >gi|336...    67   4e-010
+ref|YP_172974.1| thioredoxin [Synechococcus elongatus PCC 6301] ...    67   4e-010
+ref|ZP_00588703.1| Thioredoxin [Pelodictyon phaeoclathratiforme ...    67   4e-010
+ref|XP_652635.1| thioredoxin [Entamoeba histolytica HM-1:IMSS]         67   4e-010
+ref|YP_001112125.1| thioredoxin [Desulfotomaculum reducens MI-1]...    66   5e-010
+ref|XP_001387891.1| thioredoxin [Pichia stipitis CBS 6054] >gi|1...    66   5e-010
+ref|ZP_01424949.1| thioredoxin [Herpetosiphon aurantiacus ATCC 2...    66   5e-010
+ref|ZP_01388256.1| thioredoxin [Geobacter sp. FRC-32] >gi|110549...    66   5e-010
+ref|XP_001241048.1| hypothetical protein CIMG_08211 [Coccidioide...    66   5e-010
+ref|YP_467585.1| thioredoxin protein [Rhizobium etli CFN 42] >gi...    66   5e-010
+ref|NP_564371.1| ATO2 (Arabidopsis thioredoxin o2); thiol-disulf...    66   5e-010
+ref|YP_011056.1| thioredoxin [Desulfovibrio vulgaris subsp. vulg...    66   5e-010
+ref|NP_901254.1| thioredoxin [Chromobacterium violaceum ATCC 124...    66   5e-010
+ref|NP_742674.1| thioredoxin [Pseudomonas putida KT2440] >gi|249...    66   5e-010
+gb|AAM63200.1| thioredoxin h, putative [Arabidopsis thaliana]          66   5e-010
+ref|YP_518662.1| hypothetical protein DSY2429 [Desulfitobacteriu...    66   5e-010
+emb|CAE67470.1| Hypothetical protein CBG12973 [Caenorhabditis br...    66   5e-010
+ref|NP_001053391.1| Os04g0530600 [Oryza sativa (japonica cultiva...    66   5e-010
+sp|P33791|THIO_STRAU Thioredoxin (TRX) >gi|939972|emb|CAA51317.1...    66   5e-010
+sp|P29445|THIO1_DICDI Thioredoxin-1 >gi|167929|gb|AAA33258.1| th...    66   5e-010
+ref|ZP_01066566.1| thioredoxin [Vibrio sp. MED222] >gi|85833966|...    66   5e-010
+ref|ZP_00899774.1| Thioredoxin [Pseudomonas putida F1] >gi|82715...    66   5e-010
+ref|YP_925870.1| thioredoxin [Nocardioides sp. JS614] >gi|119539...    66   5e-010
+ref|ZP_00591865.1| Thioredoxin [Prosthecochloris aestuarii DSM 2...    66   5e-010
+ref|NP_229961.1| thioredoxin [Vibrio cholerae O1 biovar eltor st...    66   5e-010
+ref|NP_281358.1| thioredoxin [Campylobacter jejuni subsp. jejuni...    66   5e-010
+gb|EDK27638.1| thioredoxin [Vibrionales bacterium SWAT-3]              66   6e-010
+ref|ZP_01671048.1| thioredoxin [Anaeromyxobacter sp. Fw109-5] >g...    66   6e-010
+ref|ZP_01630421.1| thioredoxin [Nodularia spumigena CCY9414] >gi...    66   6e-010
+ref|ZP_01631038.1| Thioredoxin [Nodularia spumigena CCY9414] >gi...    66   6e-010
+ref|ZP_01625160.1| putative thioredoxin [marine gamma proteobact...    66   6e-010
+ref|XP_001262950.1| cytoplasmic thioredoxin, putative [Neosartor...    66   6e-010
+emb|CAL53850.1| Thioredoxin (ISS) [Ostreococcus tauri]                 66   6e-010
+emb|CAJ36398.1| thioredoxin [uncultured methanogenic archaeon RC-I]    66   6e-010
+ref|YP_610734.1| thioredoxin [Pseudomonas entomophila L48] >gi|9...    66   6e-010
+ref|ZP_01301251.1| hypothetical protein Rgryl_01000578 [Ricketts...    66   6e-010
+emb|CAJ72942.1| strongly similar to thioredoxin [Candidatus Kuen...    66   6e-010
+ref|YP_512009.1| thioredoxin [Jannaschia sp. CCS1] >gi|88866107|...    66   6e-010
+emb|CAB65014.1| thioredoxin (TRX) [Fasciola hepatica]                  66   6e-010
+ref|NP_492913.1| F56G4.5 [Caenorhabditis elegans] >gi|75024657|s...    66   6e-010
+ref|YP_203440.1| thioredoxin [Vibrio fischeri ES114] >gi|5947876...    66   6e-010
+ref|YP_465703.1| thioredoxin [Anaeromyxobacter dehalogenans 2CP-...    66   6e-010
+ref|YP_408984.1| putative thioredoxin-like protein [Shigella boy...    66   6e-010
+ref|NP_904389.1| thioredoxin [Porphyromonas gingivalis W83] >gi|...    66   6e-010
+ref|NP_013144.1| Cytoplasmic thioredoxin isoenzyme of the thiore...    66   6e-010
+ref|ZP_01171777.1| thioredoxin [Bacillus sp. NRRL B-14911] >gi|8...    66   6e-010
+ref|ZP_01160375.1| putative thioredoxin [Photobacterium sp. SKA3...    66   6e-010
+ref|YP_001112265.1| thioredoxin [Desulfotomaculum reducens MI-1]...    66   6e-010
+ref|ZP_01042971.1| Thioredoxin [Idiomarina baltica OS145] >gi|85...    66   6e-010
+ref|ZP_01036841.1| thioredoxin [Roseovarius sp. 217] >gi|8566973...    66   6e-010
+ref|ZP_01262105.1| thioredoxin [Vibrio alginolyticus 12G01] >gi|...    66   6e-010
+ref|XP_750918.1| thioredoxin, putative [Aspergillus fumigatus Af...    66   6e-010
+ref|NP_289141.1| putative thioredoxin-like protein [Escherichia ...    66   6e-010
+ref|YP_001209642.1| thioredoxin I [Dichelobacter nodosus VCS1703...    65   8e-010
+ref|XP_001409898.1| hypothetical protein MGG_12571 [Magnaporthe ...    65   8e-010
+sp|Q4UNK3|THIO_RICFE Thioredoxin (TRX)                                 65   8e-010
+ref|ZP_01688322.1| thioredoxin [Microscilla marina ATCC 23134] >...    65   8e-010
+ref|ZP_01660136.1| thiol-disulfide isomerase and thioredoxins [P...    65   8e-010
+ref|ZP_01500481.1| thioredoxin [Burkholderia phymatum STM815] >g...    65   8e-010
+gb|EAT84116.1| hypothetical protein SNOG_08948 [Phaeosphaeria no...    65   8e-010
+ref|ZP_01347121.1| hypothetical protein RcanM_01000002 [Ricketts...    65   8e-010
+emb|CAI78449.1| thioredoxin [Aspergillus fumigatus]                    65   8e-010
+gb|AAU82758.1| thioredoxin [uncultured archaeon GZfos19C8]             65   8e-010
+ref|YP_558660.1| Thioredoxin [Burkholderia xenovorans LB400] >gi...    65   8e-010
+ref|YP_181437.1| thioredoxin [Dehalococcoides ethenogenes 195] >...    65   8e-010
+ref|YP_246018.1| Thioredoxin [Rickettsia felis URRWXCal2] >gi|67...    65   8e-010
+ref|YP_286197.1| Thioredoxin [Dechloromonas aromatica RCB] >gi|7...    65   8e-010
+ref|YP_338665.1| thioredoxin [Pseudoalteromonas haloplanktis TAC...    65   8e-010
+pdb|1T00|A Chain A, The Structure Of Thioredoxin From S. Coelicolor    65   8e-010
+ref|YP_099956.1| thioredoxin [Bacteroides fragilis YCH46] >gi|60...    65   8e-010
+ref|YP_076233.1| thioredoxin [Symbiobacterium thermophilum IAM 1...    65   8e-010
+ref|NP_799380.1| thioredoxin [Vibrio parahaemolyticus RIMD 22106...    65   8e-010
+gb|EAQ71234.1| hypothetical protein MGCH7_ch7g641 [Magnaporthe g...    65   8e-010
+ref|ZP_01002298.1| thioredoxin [Loktanella vestfoldensis SKA53] ...    65   8e-010
+ref|XP_754127.1| thioredoxin Trx1, putative [Aspergillus fumigat...    65   8e-010
+ref|XP_656726.1| thioredoxin [Entamoeba histolytica HM-1:IMSS]         65   8e-010
+ref|ZP_00339725.1| COG0526: Thiol-disulfide isomerase and thiore...    65   8e-010
+ref|XP_569667.1| thioredoxin (allergen cop c 2) [Cryptococcus ne...    65   8e-010
+ref|ZP_00153076.1| COG0526: Thiol-disulfide isomerase and thiore...    65   8e-010
+
+>sp|P80028|TRXH_CHLRE Thioredoxin H-type (TRX-H) (Thioredoxin CH1)
+ emb|CAA55399.1| thioredoxin h [Chlamydomonas reinhardtii]
+ emb|CAA56850.1| thioredoxin h [Chlamydomonas reinhardtii]
+          Length = 113
+
+ Score =  196 bits (499), Expect = 2e-049
+ Identities = 98/111 (88%), Positives = 98/111 (88%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL
+Sbjct: 2   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 61
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+           K             GITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA
+Sbjct: 62  KVDVDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 112
+
+
+>pdb|1TOF|  Chain  , Thioredoxin H (Oxidized Form), Nmr, 23 Structures
+ pdb|1EP7|A Chain A, Crystal Structure Of Wt Thioredoxin H From Chlamydomonas
+           Reinhardtii
+ pdb|1EP7|B Chain B, Crystal Structure Of Wt Thioredoxin H From Chlamydomonas
+           Reinhardtii
+          Length = 112
+
+ Score =  196 bits (499), Expect = 2e-049
+ Identities = 98/111 (88%), Positives = 98/111 (88%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL
+Sbjct: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+           K             GITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA
+Sbjct: 61  KVDVDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+
+
+>pdb|1EP8|A Chain A, Crystal Structure Of A Mutated Thioredoxin, D30a, From
+           Chlamydomonas Reinhardtii
+ pdb|1EP8|B Chain B, Crystal Structure Of A Mutated Thioredoxin, D30a, From
+           Chlamydomonas Reinhardtii
+          Length = 112
+
+ Score =  193 bits (491), Expect = 2e-048
+ Identities = 97/111 (87%), Positives = 97/111 (87%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           GGSVIVIDSKAAWDAQLAKGKEEHKPIVV FTATWCGPCKMIAPLFETLSNDYAGKVIFL
+Sbjct: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVAFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+           K             GITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA
+Sbjct: 61  KVDVDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+
+
+>gb|AAU93947.1| thioredoxin H [Helicosporidium sp. ex Simulium jonesii]
+          Length = 112
+
+ Score =  108 bits (271), Expect = 6e-023
+ Identities = 53/110 (48%), Positives = 72/110 (65%), Gaps = 1/110 (0%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           GG+VI + +K  +D+ L+    + K +VVDFTATWCGPCKMIAP F  LS +Y   V+FL
+Sbjct: 2   GGAVIQVTNKTEFDSHLSTAASKGKLVVVDFTATWCGPCKMIAPFFAKLSGEYP-DVVFL 60
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
+           K             GITAMPTF  +KDG + D L GA+Q++L+A++ +HA
+Sbjct: 61  KVDVDEVEAVAAEHGITAMPTFLFFKDGKQVDSLTGANQERLRAMLTQHA 110
+
+
+>gb|AAK72483.1| thioredoxin [Branchiostoma belcheri]
+          Length = 104
+
+ Score =  100 bits (248), Expect = 3e-020
+ Identities = 52/106 (49%), Positives = 73/106 (68%), Gaps = 4/106 (3%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           V +I++KAA+D  LA   E  K IVVDFTA+WCGPC+MIAP+FE L+ +    V+F+K
+Sbjct: 2   VQMIETKAAFDKLLA---ETDKLIVVDFTASWCGPCRMIAPVFEKLAEENPD-VVFVKVD 57
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                      GI+AMPTFH Y++G K ++L GAS++KL+ +VAK+
+Sbjct: 58  VDANDETAGACGISAMPTFHCYRNGAKVEELCGASEEKLREMVAKN 103
+
+
+>emb|CAI64401.1| thioredoxin h2 protein [Zea mays]
+          Length = 122
+
+ Score = 95.1 bits (235), Expect = 1e-018
+ Identities = 49/110 (44%), Positives = 65/110 (59%), Gaps = 1/110 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   SKA +DA + K +E  K +V+DFTA WCGPC+ IAPLF   +  +  +V+FLK
+Sbjct: 6   GVVIACHSKAEFDAHMTKAQEAGKLVVIDFTAAWCGPCRAIAPLFVEHAKKFT-QVVFLK 64
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                         + AMPTFH  K+G     +VGA +D+L AL+ KHAA
+Sbjct: 65  VDVDEVKEVTAAYEVEAMPTFHFVKNGKTVATIVGAKKDELLALIEKHAA 114
+
+
+>gb|AAM67018.1| thioredoxin [Arabidopsis thaliana]
+          Length = 119
+
+ Score = 94.0 bits (232), Expect = 2e-018
+ Identities = 46/108 (42%), Positives = 60/108 (55%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   +   W  QL K KE +K IV+DFTA+WC PC+MIAP+F  L+  +    IF K
+Sbjct: 6   GQVISCHTNDVWTVQLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFK 65
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                        G+ AMPTF   K G   D LVGA+++ L+A + KH
+Sbjct: 66  VDVDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQAKIVKH 113
+
+
+>emb|CAA84610.1| thioredoxin [Arabidopsis thaliana]
+          Length = 125
+
+ Score = 93.6 bits (231), Expect = 3e-018
+ Identities = 46/108 (42%), Positives = 60/108 (55%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   +   W  QL K KE +K IV+DFTA+WC PC+MIAP+F  L+  +    IF K
+Sbjct: 6   GQVIGCHTNDVWTVQLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFK 65
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                        G+ AMPTF   K G   D LVGA+++ L+A + KH
+Sbjct: 66  VDVDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQAKIVKH 113
+
+
+>ref|NP_173403.1| ATTRX4 (thioredoxin H-type 4); thiol-disulfide exchange
+           intermediate [Arabidopsis thaliana]
+ sp|Q39239|TRXH4_ARATH Thioredoxin H-type 4 (TRX-H-4)
+ gb|AAG12565.1|AC007797_25 Unknown protein [Arabidopsis thaliana]
+ dbj|BAC43145.1| putative thioredoxin [Arabidopsis thaliana]
+ gb|AAO42956.1| At1g19730 [Arabidopsis thaliana]
+          Length = 119
+
+ Score = 93.6 bits (231), Expect = 3e-018
+ Identities = 46/108 (42%), Positives = 60/108 (55%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   +   W  QL K KE +K IV+DFTA+WC PC+MIAP+F  L+  +    IF K
+Sbjct: 6   GQVIGCHTNDVWTVQLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFK 65
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                        G+ AMPTF   K G   D LVGA+++ L+A + KH
+Sbjct: 66  VDVDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQAKIVKH 113
+
+
+>pdb|1WMJ|A Chain A, Solution Structure Of Thioredoxin Type H From Oryza Sativa
+          Length = 130
+
+ Score = 93.2 bits (230), Expect = 4e-018
+ Identities = 45/108 (41%), Positives = 63/108 (58%), Gaps = 1/108 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   +K  +DAQ+ K KE  K +++DFTA+WCGPC+ IAP+F   +  + G  +FLK
+Sbjct: 14  GVVIACHNKDEFDAQMTKAKEAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPG-AVFLK 72
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                         + AMPTF   KDG +AD +VGA +D L+  + KH
+Sbjct: 73  VDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKH 120
+
+
+>ref|NP_001059069.1| Os07g0186000 [Oryza sativa (japonica cultivar-group)]
+ sp|Q42443|TRXH_ORYSA Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein 1)
+ dbj|BAA04864.1| thioredoxin h [Oryza sativa (japonica cultivar-group)]
+ dbj|BAA05546.1| thioredoxin h [Oryza sativa]
+ gb|AAB51522.1| thioredoxin h [Oryza sativa]
+ dbj|BAC79928.1| Thioredoxin H-type (TRX-H) [Oryza sativa (japonica cultivar-group)]
+ dbj|BAD30186.1| Thioredoxin H-type (TRX-H) [Oryza sativa (japonica cultivar-group)]
+ dbj|BAF20983.1| Os07g0186000 [Oryza sativa (japonica cultivar-group)]
+ gb|EAZ03028.1| hypothetical protein OsI_024260 [Oryza sativa (indica
+           cultivar-group)]
+ gb|EAZ38949.1| hypothetical protein OsJ_022432 [Oryza sativa (japonica
+           cultivar-group)]
+          Length = 122
+
+ Score = 93.2 bits (230), Expect = 4e-018
+ Identities = 45/108 (41%), Positives = 63/108 (58%), Gaps = 1/108 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   +K  +DAQ+ K KE  K +++DFTA+WCGPC+ IAP+F   +  + G  +FLK
+Sbjct: 6   GVVIACHNKDEFDAQMTKAKEAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPG-AVFLK 64
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                         + AMPTF   KDG +AD +VGA +D L+  + KH
+Sbjct: 65  VDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKH 112
+
+
+>gb|AAS19462.1| thioredoxin [Paxillus involutus]
+          Length = 110
+
+ Score = 92.8 bits (229), Expect = 5e-018
+ Identities = 50/105 (47%), Positives = 63/105 (60%), Gaps = 5/105 (4%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAG-KVIFLKXXXX 65
+           I SKA +D  +  GK     I +DF ATWCGPCK+I+PLF+ LSN++ G  V F K
+Sbjct: 6   IKSKAHFDELINSGKT----IFIDFHATWCGPCKVISPLFQKLSNEHQGDNVAFYKVDID 61
+
+Query: 66  XXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
+                     ITAMPTF VYKDG    +L+GA+Q +L  LV +HA
+Sbjct: 62  DQAEIAQEVAITAMPTFKVYKDGALVGNLIGANQSRLTELVGEHA 106
+
+
+>emb|CAC42084.1| thioredoxin h [Pisum sativum]
+          Length = 118
+
+ Score = 91.3 bits (225), Expect = 1e-017
+ Identities = 45/107 (42%), Positives = 64/107 (59%), Gaps = 1/107 (0%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           VI + S  +W  Q+ KG E  K IVVDFTA+WCGPC+ IAP+   ++     +VIFLK
+Sbjct: 7   VIAVHSDESWKEQIQKGTESKKLIVVDFTASWCGPCRFIAPILAEIAKK-TPQVIFLKVD 65
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
+                       I AMPTF + K+G++ D +VGA +++L+  + KHA
+Sbjct: 66  IDELESVAEEWSIEAMPTFLLLKEGMEVDKVVGAKKEELQLAITKHA 112
+
+
+>gb|AAL26915.1|AF323593_1 thioredoxin H [Prunus persica]
+          Length = 136
+
+ Score = 91.3 bits (225), Expect = 1e-017
+ Identities = 48/108 (44%), Positives = 63/108 (58%), Gaps = 1/108 (0%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           VI   +  AW+ QL KG E  K +VVDFTA+WCGPC++IAP+   L+     +V FLK
+Sbjct: 7   VIGCHTTQAWEEQLHKGNENKKLVVVDFTASWCGPCRLIAPILAELAKK-TPEVTFLKVD 65
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                      G+ AMPTF   K+G   D +VGA +D+L+  VAKH A
+Sbjct: 66  VDELRTVSEEWGVEAMPTFLFLKEGKIVDKVVGAKKDELQIKVAKHVA 113
+
+
+>gb|AAO12854.1| thioredoxin h [Pisum sativum]
+          Length = 113
+
+ Score = 91.3 bits (225), Expect = 1e-017
+ Identities = 49/110 (44%), Positives = 62/110 (56%), Gaps = 1/110 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI + +  AW  QL KGK   K IVVDFTA+WCGPC+ IAP+   ++      V FLK
+Sbjct: 5   GQVIGVHTVDAWKEQLEKGKASKKLIVVDFTASWCGPCRFIAPILAEIAKKLT-HVTFLK 63
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                        GI AMPTF   KDG   D +VGA +++L+  + KHAA
+Sbjct: 64  VDVDELKTVSEEWGIEAMPTFLFLKDGELVDKVVGAKKEELQLKIDKHAA 113
+
+
+>gb|AAL99941.1| thioredoxin H [Populus tremula x Populus tremuloides]
+          Length = 114
+
+ Score = 90.5 bits (223), Expect = 2e-017
+ Identities = 50/109 (45%), Positives = 57/109 (52%), Gaps = 1/109 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   +   W     KGK   K IVVDFTA+WC PCKMIAP+F  L+  +   V FLK
+Sbjct: 5   GQVIACHTVDTWKEHFEKGKGSQKLIVVDFTASWCPPCKMIAPIFAELAKKFP-NVTFLK 63
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
+                         + AMPTF   KDG   D  VGA +D L  LVAKHA
+Sbjct: 64  VDVDELKAVAEEWNVEAMPTFIFLKDGKLVDKTVGADKDGLPTLVAKHA 112
+
+
+>pdb|1TI3|A Chain A, Solution Structure Of The Thioredoxin H1 From Poplar, A
+           Cppc Active Site Variant
+          Length = 113
+
+ Score = 90.5 bits (223), Expect = 2e-017
+ Identities = 50/109 (45%), Positives = 57/109 (52%), Gaps = 1/109 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   +   W     KGK   K IVVDFTA+WC PCKMIAP+F  L+  +   V FLK
+Sbjct: 4   GQVIACHTVDTWKEHFEKGKGSQKLIVVDFTASWCPPCKMIAPIFAELAKKFP-NVTFLK 62
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
+                         + AMPTF   KDG   D  VGA +D L  LVAKHA
+Sbjct: 63  VDVDELKAVAEEWNVEAMPTFIFLKDGKLVDKTVGADKDGLPTLVAKHA 111
+
+
+>ref|XP_001419941.1| predicted protein [Ostreococcus lucimarinus CCE9901]
+ gb|ABO98234.1| predicted protein [Ostreococcus lucimarinus CCE9901]
+          Length = 105
+
+ Score = 90.1 bits (222), Expect = 3e-017
+ Identities = 46/91 (50%), Positives = 57/91 (62%), Gaps = 1/91 (1%)
+
+Query: 16  QLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXG 75
+           + A  K   KP+VVDFTA+WCGPCK IAP FE L+  Y  +V F+K             G
+Sbjct: 10  EFAAIKAAGKPVVVDFTASWCGPCKSIAPFFEELAAKYP-EVEFVKIDVDELEDVAAECG 68
+
+Query: 76  ITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+           I+AMPTF VY +GVK  ++ GA +DKL ALV
+Sbjct: 69  ISAMPTFQVYSNGVKVSEMTGADKDKLSALV 99
+
+
+>gb|AAQ23135.1| thioredoxin H3 [Ipomoea batatas]
+          Length = 123
+
+ Score = 90.1 bits (222), Expect = 3e-017
+ Identities = 47/110 (42%), Positives = 62/110 (56%), Gaps = 1/110 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   +   W  Q AKG E  + +VVDFTA+WCGPC+MIAP+   ++   A  VIF+K
+Sbjct: 10  GQVIACHTVDHWKEQFAKGVETKRLVVVDFTASWCGPCRMIAPILAEIAKKMA-HVIFVK 68
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                         + AMPTF   KDG + D +VGA +D L+  + KHAA
+Sbjct: 69  VDVDELQAVAAEYKVEAMPTFVFLKDGKEVDRMVGAKKDDLQNCITKHAA 118
+
+
+>sp|Q39362|TRXH2_BRANA Thioredoxin H-type 2 (TRX-H-2)
+ gb|AAB53695.1| thioredoxin-h-like-2
+          Length = 119
+
+ Score = 90.1 bits (222), Expect = 3e-017
+ Identities = 45/108 (41%), Positives = 59/108 (54%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI       W  QL   K+ +K IV+DFTA+WC PC+MIAP+F  L+  +    IF K
+Sbjct: 6   GQVIGCHEIDVWAVQLDTAKQSNKLIVIDFTASWCPPCRMIAPVFADLAKKFMSSAIFFK 65
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                        G+ AMPTF + KDG   D +VGA ++ L A +AKH
+Sbjct: 66  VDVDELQNVAQEFGVEAMPTFVLIKDGNVVDKVVGARKEDLHATIAKH 113
+
+
+>gb|AAC49355.1| thioredoxin h
+          Length = 110
+
+ Score = 88.6 bits (218), Expect = 9e-017
+ Identities = 44/105 (41%), Positives = 58/105 (55%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   +   W  QL K KE +K IV+DFTA+WC PC+MIAP+F  L+  +    IF K
+Sbjct: 6   GQVIGCHTNDVWTVQLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFK 65
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                        G+ AMPTF   K G   D LVGA+++ L+A +
+Sbjct: 66  VDVDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQAKI 110
+
+
+>gb|ABB53600.1| thioredoxin h [Eucalyptus grandis]
+          Length = 117
+
+ Score = 88.2 bits (217), Expect = 1e-016
+ Identities = 46/110 (41%), Positives = 60/110 (54%), Gaps = 1/110 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   S  +W  Q+AK  E  K +VVDFTA+WCGPC+ IAP    L+  +   V+FLK
+Sbjct: 5   GQVISCHSAESWSEQIAKSNESDKLVVVDFTASWCGPCRFIAPFLAELAKRFP-NVLFLK 63
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                         + AMPTF   K G   D +VGA +D+L+  +AKH A
+Sbjct: 64  VDVDELKTVAQEWAVEAMPTFMFVKGGKIVDRVVGAQKDQLQMTLAKHMA 113
+
+
+>ref|NP_001002461.1| hypothetical protein LOC436734 [Danio rerio]
+ gb|AAH76358.1| Zgc:92903 [Danio rerio]
+          Length = 107
+
+ Score = 88.2 bits (217), Expect = 1e-016
+ Identities = 47/107 (43%), Positives = 62/107 (57%), Gaps = 3/107 (2%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGK-VIFLKX 62
+           V+ I+ KAA+D  L    +  K +VVDFTATWCGPC+ I P F+ LS     K V+FLK
+Sbjct: 2   VLEIEDKAAFDNALKNAGD--KLVVVDFTATWCGPCQTIGPYFKLLSEKPENKNVVFLKV 59
+
+Query: 63  XXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                       GI+ MPTFH YK+G K D+  G++Q KL+  +  H
+Sbjct: 60  DVDDAQDVAALCGISCMPTFHFYKNGKKVDEFSGSNQSKLEEKINSH 106
+
+
+>pdb|1XFL|A Chain A, Solution Structure Of Thioredoxin H1 From Arabidopsis
+           Thaliana
+          Length = 124
+
+ Score = 88.2 bits (217), Expect = 1e-016
+ Identities = 46/110 (41%), Positives = 60/110 (54%), Gaps = 1/110 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   +   W+ QL K  E    +VVDFTA+WCGPC+ IAP F  L+      V+FLK
+Sbjct: 16  GQVIACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLP-NVLFLK 74
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                         I AMPTF   K+G   D +VGA +D+L++ +AKH A
+Sbjct: 75  VDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKHLA 124
+
+
+>ref|NP_190672.1| ATTRX1 (Arabidopsis thaliana thioredoxin H-type 1); thiol-disulfide
+           exchange intermediate
+ sp|P29448|TRXH1_ARATH Thioredoxin H-type 1 (TRX-H-1)
+ emb|CAA78462.1| Thioredoxin H [Arabidopsis thaliana]
+ gb|AAC49354.1| thioredoxin h
+ emb|CAB62625.1| thioredoxin h [Arabidopsis thaliana]
+ gb|AAM67008.1| thioredoxin h [Arabidopsis thaliana]
+          Length = 114
+
+ Score = 88.2 bits (217), Expect = 1e-016
+ Identities = 46/110 (41%), Positives = 60/110 (54%), Gaps = 1/110 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   +   W+ QL K  E    +VVDFTA+WCGPC+ IAP F  L+      V+FLK
+Sbjct: 6   GQVIACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLP-NVLFLK 64
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                         I AMPTF   K+G   D +VGA +D+L++ +AKH A
+Sbjct: 65  VDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKHLA 114
+
+
+>emb|CAG05766.1| unnamed protein product [Tetraodon nigroviridis]
+          Length = 109
+
+ Score = 87.4 bits (215), Expect = 2e-016
+ Identities = 49/107 (45%), Positives = 67/107 (62%), Gaps = 3/107 (2%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGK-VIFLKX 62
+           VIVI+S+A +D  +     E K +VVDFTA WCGPCK I P+F++LS+    K VIFLK
+Sbjct: 3   VIVIESEAQFDDYIKN--IEGKLVVVDFTAQWCGPCKHIGPVFKSLSDMGDNKNVIFLKV 60
+
+Query: 63  XXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                        ++AMPTF  +KDGVK D+++GA+Q +L   + KH
+Sbjct: 61  DVDELEDLAARCKVSAMPTFLFFKDGVKIDEVIGANQPQLVEKIQKH 107
+
+
+>ref|NP_956317.1| hypothetical protein LOC336637 [Danio rerio]
+ ref|XP_001331501.1| PREDICTED: hypothetical protein [Danio rerio]
+ gb|AAH49031.1| Zgc:56493 [Danio rerio]
+          Length = 108
+
+ Score = 87.0 bits (214), Expect = 3e-016
+ Identities = 47/108 (43%), Positives = 65/108 (60%), Gaps = 5/108 (4%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSN--DYAGKVIFLK 61
+           ++VI+ +  +D  LA   +  K +VVDFTATWCGPC+ IAP ++ LS   DY+  V+FLK
+Sbjct: 2   IVVIEDQDGFDKALAGAGD--KLVVVDFTATWCGPCQSIAPFYKGLSENPDYS-NVVFLK 58
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                         I  MPTFH YK+G K DD  G++Q KL+ +V +H
+Sbjct: 59  VDVDDAQDVAQSCEIKCMPTFHFYKNGKKLDDFSGSNQTKLEEMVKQH 106
+
+
+>gb|AAL67139.1| thioredoxin H [Triticum aestivum]
+          Length = 118
+
+ Score = 86.3 bits (212), Expect = 4e-016
+ Identities = 45/114 (39%), Positives = 64/114 (56%), Gaps = 5/114 (4%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G+VI   +K  +D  +A GKE  K +++DFTA+WCGPC++IAP+F   +  + G  IFLK
+Sbjct: 6   GAVIACHTKQEFDTHMANGKETGKLVIIDFTASWCGPCRVIAPVFAEYAKKFPG-AIFLK 64
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQD----KLKALVAKHAA 111
+                         + AMPTF   KDG K D +VG  +D    K+ AL+   +A
+Sbjct: 65  VDVDELKDVAEAYNVEAMPTFLFIKDGAKVDTVVGGRKDDIHTKIVALMGSASA 118
+
+
+>ref|NP_491127.1| Y54E10A.3 [Caenorhabditis elegans]
+ gb|AAF66636.1|AF143405_1 thioredoxin-like protein TXL [Caenorhabditis elegans]
+ gb|AAF60759.1| Hypothetical protein Y54E10A.3 [Caenorhabditis elegans]
+ gb|AAF66677.1| thioredoxin-like protein [Caenorhabditis elegans]
+          Length = 284
+
+ Score = 86.3 bits (212), Expect = 4e-016
+ Identities = 40/86 (46%), Positives = 53/86 (61%), Gaps = 1/86 (1%)
+
+Query: 25  KPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHV 84
+           K ++VDFTA WCGPCKMIAP FE LSN Y G  +FLK             G+ +MPTF V
+Sbjct: 22  KSVIVDFTAVWCGPCKMIAPTFEALSNQYLG-AVFLKVDVEICEKTSSENGVNSMPTFMV 80
+
+Query: 85  YKDGVKADDLVGASQDKLKALVAKHA 110
+           ++ GV+ + + GA    L+ +V K+A
+Sbjct: 81  FQSGVRVEQMKGADAKALETMVKKYA 106
+
+
+>gb|AAZ98842.1| thioredoxin h1 [Medicago truncatula]
+          Length = 117
+
+ Score = 85.9 bits (211), Expect = 6e-016
+ Identities = 45/109 (41%), Positives = 59/109 (54%), Gaps = 1/109 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI + +  AW   L KG    K IVVDFTA+WCGPC+ IAP+   ++      V FLK
+Sbjct: 6   GHVIGVHTVEAWKEHLEKGNGSKKLIVVDFTASWCGPCRFIAPILAEIAKKLP-NVTFLK 64
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
+                         + AMPTF   K+G   D +VGA +D+L+A + KHA
+Sbjct: 65  VDVDELKTVAEEWAVDAMPTFLFLKEGKLVDKVVGAQKDQLQAAITKHA 113
+
+
+>emb|CAE54120.1| thioredoxin-1 [Mesobuthus cyprius]
+ emb|CAE54122.1| thioredoxin-1 [Mesobuthus cyprius]
+ emb|CAE54123.1| thioredoxin-1 [Mesobuthus cyprius]
+ emb|CAE54124.1| thioredoxin-1 [Mesobuthus cyprius]
+ emb|CAE54125.1| thioredoxin-1 [Mesobuthus cyprius]
+ emb|CAE54126.1| thioredoxin-1 [Mesobuthus cyprius]
+          Length = 126
+
+ Score = 85.5 bits (210), Expect = 8e-016
+ Identities = 44/105 (41%), Positives = 62/105 (59%), Gaps = 3/105 (2%)
+
+Query: 5   IVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXX 64
+           +V+D K  +D+Q+    E  K +V+DF ATWCGPCK IAP  E L  + +G V+FLK
+Sbjct: 21  LVVD-KEDYDSQMEAAGE--KLVVIDFFATWCGPCKQIAPFIEKLEQENSGNVVFLKVDV 77
+
+Query: 65  XXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                      ++ MPTF + K+  K D+  GA+Q+KLK +V KH
+Sbjct: 78  DENEELAQTFNVSCMPTFILLKNRNKVDEFSGANQEKLKEMVDKH 122
+
+
+>gb|AAR83852.1| thioredoxin [Capsicum annuum]
+ gb|ABN42904.1| thioredoxin H-type [Capsicum annuum]
+          Length = 124
+
+ Score = 85.5 bits (210), Expect = 8e-016
+ Identities = 43/108 (39%), Positives = 59/108 (54%), Gaps = 1/108 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G V    +   WD    KG E  K +VVDFTA+WCGPC+ IAP+   ++      VIFLK
+Sbjct: 9   GQVFGCHNVEEWDQHFKKGVETKKLVVVDFTASWCGPCRFIAPILADIAKKMP-HVIFLK 67
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                         + AMPTF  +KDG + D +VGA +++L+A + KH
+Sbjct: 68  VDVDELKTVAEEWNVDAMPTFVFFKDGEEVDRVVGAQKEELQAAILKH 115
+
+
+>emb|CAE68992.1| Hypothetical protein CBG14979 [Caenorhabditis briggsae]
+          Length = 283
+
+ Score = 85.5 bits (210), Expect = 8e-016
+ Identities = 43/105 (40%), Positives = 64/105 (60%), Gaps = 3/105 (2%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           VI++     +  QL+      KP++VDFTA WCGPCKMIAP FE LSN + G  +FLK
+Sbjct: 3   VIIVKDDEDFKTQLSLAGA--KPVIVDFTAVWCGPCKMIAPAFEALSNQHLG-AVFLKVD 59
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAK 108
+                      G+++MPTF V+++G   + + GA+++ L+A+V K
+Sbjct: 60  VDVCEATCATYGVSSMPTFIVFQNGRNVETMKGANREGLEAMVKK 104
+
+
+>pdb|2J23|A Chain A, Cross-Reactivity And Crystal Structure Of Malassezia
+           Sympodialis Thioredoxin (Mala S 13), A Member Of A New
+           Pan- Allergen Family
+ pdb|2J23|B Chain B, Cross-Reactivity And Crystal Structure Of Malassezia
+           Sympodialis Thioredoxin (Mala S 13), A Member Of A New
+           Pan- Allergen Family
+          Length = 121
+
+ Score = 84.7 bits (208), Expect = 1e-015
+ Identities = 51/111 (45%), Positives = 65/111 (58%), Gaps = 5/111 (4%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAG-KVIFL 60
+           GSV VI S   +  Q+  G    K +V+DF ATWCGPCKMI P+FE +S+  AG KV F
+Sbjct: 15  GSVQVISSYDQFK-QVTGGD---KVVVIDFWATWCGPCKMIGPVFEKISDTPAGDKVGFY 70
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+           K             GI AMPTF  +K+G K D +VGA   KL+A + +H+A
+Sbjct: 71  KVDVDEQSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPSKLQAAITQHSA 121
+
+
+>gb|AAZ32865.1| thioredoxin h [Medicago sativa]
+          Length = 117
+
+ Score = 84.7 bits (208), Expect = 1e-015
+ Identities = 44/109 (40%), Positives = 59/109 (54%), Gaps = 1/109 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI + +  AW   L KG    K IVVDFTA+WCGPC+ IAP+   ++      V FLK
+Sbjct: 6   GQVIGVHTVEAWKEHLEKGNGSKKLIVVDFTASWCGPCRFIAPILAEIAKKLP-NVTFLK 64
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
+                         + AMPTF   K+G   D +VGA +++L+A + KHA
+Sbjct: 65  VDVDELKTVAEEWAVDAMPTFLFLKEGKLVDKVVGAQKEQLQAAITKHA 113
+
+
+>sp|Q07090|TRXH2_TOBAC Thioredoxin H-type 2 (TRX-H2)
+ emb|CAA77847.1| THIOREDOXIN [Nicotiana tabacum]
+ prf||1913431A thioredoxin
+          Length = 118
+
+ Score = 84.7 bits (208), Expect = 1e-015
+ Identities = 45/108 (41%), Positives = 60/108 (55%), Gaps = 1/108 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI + +  AW+  L KG ++ K IVVDFTA+WCGPCK IA  +  L+      V FLK
+Sbjct: 5   GQVIGVHTVDAWNEHLQKGIDDKKLIVVDFTASWCGPCKFIASFYAELAKKMP-TVTFLK 63
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                         + AMPTF   K+G   D +VGA +D+L+  +AKH
+Sbjct: 64  VDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQQTIAKH 111
+
+
+>emb|CAI78451.1| thioredoxin [Malassezia sympodialis]
+          Length = 105
+
+ Score = 84.3 bits (207), Expect = 2e-015
+ Identities = 43/88 (48%), Positives = 55/88 (62%), Gaps = 1/88 (1%)
+
+Query: 25  KPIVVDFTATWCGPCKMIAPLFETLSNDYAG-KVIFLKXXXXXXXXXXXXXGITAMPTFH 83
+           K +V+DF ATWCGPCKMI P+FE +S+  AG KV F K             GI AMPTF
+Sbjct: 18  KVVVIDFWATWCGPCKMIGPVFEKISDTPAGDKVGFYKVDVDEQSQIAQEVGIRAMPTFV 77
+
+Query: 84  VYKDGVKADDLVGASQDKLKALVAKHAA 111
+            +K+G K D +VGA   KL+A + +H+A
+Sbjct: 78  FFKNGQKIDTVVGADPSKLQAAITQHSA 105
+
+
+>emb|CAE54169.1| thioredoxin-1 [Mesobuthus gibbosus]
+          Length = 126
+
+ Score = 84.3 bits (207), Expect = 2e-015
+ Identities = 43/105 (40%), Positives = 62/105 (59%), Gaps = 3/105 (2%)
+
+Query: 5   IVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXX 64
+           +V+D K  +D+Q+    E  K +V+DF ATWCGPCK IAP  E L  + +G V+FLK
+Sbjct: 21  LVVD-KEDYDSQMEAAGE--KLVVIDFFATWCGPCKQIAPFIEKLEQENSGNVVFLKVDV 77
+
+Query: 65  XXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                      ++ MPTF + K+  K D+  GA+Q+KL+ +V KH
+Sbjct: 78  DENEELAQTFNVSCMPTFILLKNRNKVDEFSGANQEKLREMVDKH 122
+
+
+>emb|CAE54129.1| thioredoxin-1 [Mesobuthus gibbosus]
+          Length = 126
+
+ Score = 84.3 bits (207), Expect = 2e-015
+ Identities = 43/105 (40%), Positives = 62/105 (59%), Gaps = 3/105 (2%)
+
+Query: 5   IVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXX 64
+           +V+D K  +D+Q+    E  K +V+DF ATWCGPCK IAP  E L  + +G V+FLK
+Sbjct: 21  LVVD-KEDYDSQMEAAGE--KLVVIDFFATWCGPCKQIAPFIEKLEQENSGNVVFLKVDV 77
+
+Query: 65  XXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                      ++ MPTF + K+  K D+  GA+Q+KL+ +V KH
+Sbjct: 78  DENEELAQTFNVSCMPTFILLKNRNKVDEFSGANQEKLRXMVDKH 122
+
+
+>emb|CAE54152.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54153.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54155.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54156.1| thioredoxin-1 [Mesobuthus gibbosus]
+          Length = 126
+
+ Score = 84.3 bits (207), Expect = 2e-015
+ Identities = 43/105 (40%), Positives = 62/105 (59%), Gaps = 3/105 (2%)
+
+Query: 5   IVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXX 64
+           +V+D K  +D+Q+    E  K +V+DF ATWCGPCK IAP  E L  + +G V+FLK
+Sbjct: 21  LVVD-KEDYDSQMEAAGE--KLVVIDFFATWCGPCKQIAPFIEKLEQENSGNVVFLKVDV 77
+
+Query: 65  XXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                      ++ MPTF + K+  K D+  GA+Q+KL+ +V KH
+Sbjct: 78  DENEELAQTFNVSCMPTFILLKNRNKVDEFSGANQEKLREMVDKH 122
+
+
+>emb|CAE54157.1| thioredoxin-1 [Mesobuthus gibbosus]
+          Length = 126
+
+ Score = 84.3 bits (207), Expect = 2e-015
+ Identities = 43/105 (40%), Positives = 62/105 (59%), Gaps = 3/105 (2%)
+
+Query: 5   IVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXX 64
+           +V+D K  +D+Q+    E  K +V+DF ATWCGPCK IAP  E L  + +G V+FLK
+Sbjct: 21  LVVD-KEDYDSQMEAAGE--KLVVIDFFATWCGPCKQIAPFIEKLEQENSGNVVFLKVDV 77
+
+Query: 65  XXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                      ++ MPTF + K+  K D+  GA+Q+KL+ +V KH
+Sbjct: 78  DENEELAQTFNVSCMPTFILLKNRNKVDEFSGANQEKLREMVDKH 122
+
+
+>emb|CAE54127.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54128.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54130.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54131.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54133.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54134.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54135.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54138.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54139.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54140.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54141.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54146.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54147.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54148.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54149.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54150.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54151.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54158.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54159.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54160.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54161.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54162.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54163.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54164.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54177.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54179.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54180.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54181.1| thioredoxin-1 [Mesobuthus gibbosus]
+          Length = 126
+
+ Score = 84.3 bits (207), Expect = 2e-015
+ Identities = 43/105 (40%), Positives = 62/105 (59%), Gaps = 3/105 (2%)
+
+Query: 5   IVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXX 64
+           +V+D K  +D+Q+    E  K +V+DF ATWCGPCK IAP  E L  + +G V+FLK
+Sbjct: 21  LVVD-KEDYDSQMEAAGE--KLVVIDFFATWCGPCKQIAPFIEKLEQENSGNVVFLKVDV 77
+
+Query: 65  XXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                      ++ MPTF + K+  K D+  GA+Q+KL+ +V KH
+Sbjct: 78  DENEELAQTFNVSCMPTFILLKNRNKVDEFSGANQEKLREMVDKH 122
+
+
+>emb|CAE54137.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54142.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54144.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54145.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54166.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54167.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54168.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54170.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54171.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54172.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54173.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54174.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54175.1| thioredoxin-1 [Mesobuthus gibbosus]
+ emb|CAE54178.1| thioredoxin-1 [Mesobuthus gibbosus]
+          Length = 126
+
+ Score = 84.3 bits (207), Expect = 2e-015
+ Identities = 43/105 (40%), Positives = 62/105 (59%), Gaps = 3/105 (2%)
+
+Query: 5   IVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXX 64
+           +V+D K  +D+Q+    E  K +V+DF ATWCGPCK IAP  E L  + +G V+FLK
+Sbjct: 21  LVVD-KEDYDSQMEAAGE--KLVVIDFFATWCGPCKQIAPFIEKLEQENSGNVVFLKVDV 77
+
+Query: 65  XXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                      ++ MPTF + K+  K D+  GA+Q+KL+ +V KH
+Sbjct: 78  DENEELAQTFNVSCMPTFILLKNRNKVDEFSGANQEKLREMVDKH 122
+
+
+>gb|AAP72290.1| thioredoxin h isoform 1; HvTrxh1 [Hordeum vulgare subsp. vulgare]
+          Length = 118
+
+ Score = 84.3 bits (207), Expect = 2e-015
+ Identities = 40/101 (39%), Positives = 58/101 (57%), Gaps = 1/101 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G+VI   +K  +D  +A GK+  K +++DFTA+WCGPC++IAP+F   +  + G  IFLK
+Sbjct: 6   GAVIACHTKQEFDTHMANGKDTGKLVIIDFTASWCGPCRVIAPVFAEYAKKFPG-AIFLK 64
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKL 102
+                         + AMPTF   KDG K D +VG  +D +
+Sbjct: 65  VDVDELKDVAEAYNVEAMPTFLFIKDGEKVDSVVGGRKDDI 105
+
+
+>ref|XP_001348719.1| thioredoxin [Plasmodium falciparum 3D7]
+ sp|Q7KQL8|THIO_PLAF7 Thioredoxin
+ gb|AAN37158.1|AE014825_17 thioredoxin [Plasmodium falciparum 3D7]
+ emb|CAB90828.1| thioredoxin [Plasmodium falciparum 3D7]
+          Length = 104
+
+ Score = 84.3 bits (207), Expect = 2e-015
+ Identities = 43/108 (39%), Positives = 65/108 (60%), Gaps = 5/108 (4%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           V ++ S+A +D+ ++    +++ ++VDF A WCGPCK IAP +E  S  Y  K++F+K
+Sbjct: 2   VKIVTSQAEFDSIIS----QNELVIVDFFAEWCGPCKRIAPFYEECSKTYT-KMVFIKVD 56
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                       IT+MPTF VYK+G   D L+GA+   LK L+ K+AA
+Sbjct: 57  VDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKYAA 104
+
+
+>pdb|1SYR|A Chain A, Initial Structural Analysis Of Plasmodium Falciparum
+           Thioredoxin
+ pdb|1SYR|B Chain B, Initial Structural Analysis Of Plasmodium Falciparum
+           Thioredoxin
+ pdb|1SYR|C Chain C, Initial Structural Analysis Of Plasmodium Falciparum
+           Thioredoxin
+ pdb|1SYR|D Chain D, Initial Structural Analysis Of Plasmodium Falciparum
+           Thioredoxin
+ pdb|1SYR|E Chain E, Initial Structural Analysis Of Plasmodium Falciparum
+           Thioredoxin
+ pdb|1SYR|F Chain F, Initial Structural Analysis Of Plasmodium Falciparum
+           Thioredoxin
+ pdb|1SYR|G Chain G, Initial Structural Analysis Of Plasmodium Falciparum
+           Thioredoxin
+ pdb|1SYR|H Chain H, Initial Structural Analysis Of Plasmodium Falciparum
+           Thioredoxin
+ pdb|1SYR|I Chain I, Initial Structural Analysis Of Plasmodium Falciparum
+           Thioredoxin
+ pdb|1SYR|J Chain J, Initial Structural Analysis Of Plasmodium Falciparum
+           Thioredoxin
+ pdb|1SYR|K Chain K, Initial Structural Analysis Of Plasmodium Falciparum
+           Thioredoxin
+ pdb|1SYR|L Chain L, Initial Structural Analysis Of Plasmodium Falciparum
+           Thioredoxin
+          Length = 112
+
+ Score = 84.3 bits (207), Expect = 2e-015
+ Identities = 43/108 (39%), Positives = 65/108 (60%), Gaps = 5/108 (4%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           V ++ S+A +D+ ++    +++ ++VDF A WCGPCK IAP +E  S  Y  K++F+K
+Sbjct: 10  VKIVTSQAEFDSIIS----QNELVIVDFFAEWCGPCKRIAPFYEECSKTYT-KMVFIKVD 64
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                       IT+MPTF VYK+G   D L+GA+   LK L+ K+AA
+Sbjct: 65  VDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKYAA 112
+
+
+>sp|Q9UW02|THIO_COPCM Thioredoxin (Allergen Cop c 2)
+ emb|CAB52130.1| thioredoxin [Coprinus comatus]
+          Length = 106
+
+ Score = 84.3 bits (207), Expect = 2e-015
+ Identities = 42/88 (47%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
+
+Query: 25  KPIVVDFTATWCGPCKMIAPLFETLSNDY-AGKVIFLKXXXXXXXXXXXXXGITAMPTFH 83
+           K I++DF ATWCGPC++I+P+FE  S  Y A  ++F K              I AMPTF
+Sbjct: 19  KIIIIDFWATWCGPCRVISPIFEKFSEKYGANNIVFAKVDVDTASDISEEAKIRAMPTFQ 78
+
+Query: 84  VYKDGVKADDLVGASQDKLKALVAKHAA 111
+           VYKDG K D+LVGA+   L++LV K  A
+Sbjct: 79  VYKDGQKIDELVGANPTALESLVQKSLA 106
+
+
+>emb|CAE54136.1| thioredoxin-1 [Mesobuthus gibbosus]
+          Length = 126
+
+ Score = 84.0 bits (206), Expect = 2e-015
+ Identities = 43/105 (40%), Positives = 62/105 (59%), Gaps = 3/105 (2%)
+
+Query: 5   IVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXX 64
+           +V+D K  +D+Q+    E  K +V+DF ATWCGPCK IAP  E L  + +G V+FLK
+Sbjct: 21  LVVD-KEDYDSQMEAAGE--KLVVIDFFATWCGPCKXIAPFIEKLEQENSGNVVFLKVDV 77
+
+Query: 65  XXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                      ++ MPTF + K+  K D+  GA+Q+KL+ +V KH
+Sbjct: 78  DENEELAQTFNVSCMPTFILLKNRNKVDEFSGANQEKLREMVDKH 122
+
+
+>gb|AAZ98843.1| thioredoxin h2 [Medicago truncatula]
+          Length = 120
+
+ Score = 83.6 bits (205), Expect = 3e-015
+ Identities = 41/108 (37%), Positives = 61/108 (56%), Gaps = 1/108 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI + +   W  ++ KG +  K IVVDFTA+WCGPC+ IAP+   ++     +VIFLK
+Sbjct: 6   GQVIGVHTVEQWKEEIQKGNDSKKLIVVDFTASWCGPCRFIAPILAEIAKKIP-EVIFLK 64
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                         + AMPTF   K+G + D +VGA +++L+  + KH
+Sbjct: 65  VDIDEVKSVAKEWSVEAMPTFLFLKEGKEVDKVVGARKEELENAITKH 112
+
+
+>sp|Q43636|TRXH_RICCO Thioredoxin H-type (TRX-H)
+ emb|CAA94534.1| thioredoxin [Ricinus communis]
+          Length = 118
+
+ Score = 83.6 bits (205), Expect = 3e-015
+ Identities = 45/110 (40%), Positives = 59/110 (53%), Gaps = 1/110 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   +  AW+ QL KG +    IVVDFTA+WCGPC+ IAP    L+      V FLK
+Sbjct: 6   GQVIGCHTVEAWNEQLQKGNDTKGLIVVDFTASWCGPCRFIAPFLAELAKKLP-NVTFLK 64
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                         + +MPTF   K+G   D +VGA +D+L+  +AKH A
+Sbjct: 65  VDVDELKTVAHEWAVESMPTFMFLKEGKIMDKVVGAKKDELQQTIAKHMA 114
+
+
+>gb|ABN07937.1| Thioredoxin domain 2; Thioredoxin fold [Medicago truncatula]
+          Length = 134
+
+ Score = 83.2 bits (204), Expect = 4e-015
+ Identities = 41/109 (37%), Positives = 62/109 (56%), Gaps = 1/109 (0%)
+
+Query: 3   SVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKX 62
+           SV    S A W     + K+  + +V+DF+ATWCGPCKM+ P+ + ++N++   V F+K
+Sbjct: 27  SVKTFHSSARWQLHFNELKDSPRLVVIDFSATWCGPCKMMEPILQAMANEFT-DVEFIKI 85
+
+Query: 63  XXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                        + AMPTF + K+G + D +VGA +D+LK  V KH A
+Sbjct: 86  DVDELSDVAQEFKVQAMPTFLLLKNGKEVDKVVGAKKDELKNKVQKHKA 134
+
+
+>gb|ABL67654.1| putative H-type thioredoxin [Citrus cv. Shiranuhi]
+          Length = 119
+
+ Score = 83.2 bits (204), Expect = 4e-015
+ Identities = 43/110 (39%), Positives = 60/110 (54%), Gaps = 1/110 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   +  AW+ QL K  E  + +VVDFTA+WCGPC+ IAP    L+      V+FLK
+Sbjct: 7   GQVIGCHTVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLP-NVLFLK 65
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                         + AMPTF   K+G   D +VG+ +++L+  +AKH A
+Sbjct: 66  VDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIAKHLA 115
+
+
+>ref|NP_500036.2| Y55F3AR.2 [Caenorhabditis elegans]
+ gb|AAF60805.2| Hypothetical protein Y55F3AR.2 [Caenorhabditis elegans]
+          Length = 254
+
+ Score = 83.2 bits (204), Expect = 4e-015
+ Identities = 43/108 (39%), Positives = 64/108 (59%), Gaps = 3/108 (2%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           VIV++  + +D + + G    K + VDFTA+WCGPC+ IAP+F  L+N Y G V FLK
+Sbjct: 3   VIVVNGDSDFDRKFSAGNG--KAVFVDFTASWCGPCQYIAPIFSDLANQYKGSV-FLKVD 59
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                      G+ AMPTF  + +G K   + GA +  L+++VAK+A+
+Sbjct: 60  VDECRGTAATYGVNAMPTFIAFVNGQKKATIQGADESGLRSMVAKYAS 107
+
+
+>gb|AAP33009.1| thioredoxin H [Citrus x paradisi]
+          Length = 123
+
+ Score = 83.2 bits (204), Expect = 4e-015
+ Identities = 45/109 (41%), Positives = 61/109 (55%), Gaps = 1/109 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   +  +W+ QL KG    K IVVDFTA+WC PCK+++P+   L+      VIFLK
+Sbjct: 5   GQVISCHTVESWNEQLQKGIAAKKLIVVDFTASWCPPCKLMSPILSELAKKLPA-VIFLK 63
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
+                         + AMPTF + KDG   + +VGA +D+L+  V KHA
+Sbjct: 64  VDVDELQSVAEEWAVEAMPTFVLTKDGKVLERIVGAKKDELQLAVEKHA 112
+
+
+>emb|CAG05767.1| unnamed protein product [Tetraodon nigroviridis]
+          Length = 106
+
+ Score = 83.2 bits (204), Expect = 4e-015
+ Identities = 41/89 (46%), Positives = 53/89 (59%), Gaps = 1/89 (1%)
+
+Query: 21  KEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGK-VIFLKXXXXXXXXXXXXXGITAM 79
+           + +HK +VVDFTA+WCGPCK I P+FE LSN+   K ++FLK              I  M
+Sbjct: 17  EHKHKLVVVDFTASWCGPCKQIGPVFEKLSNEPENKDIVFLKVDVDDAGDVSEFCQIKCM 76
+
+Query: 80  PTFHVYKDGVKADDLVGASQDKLKALVAK 108
+           PTF  YK+G K D+  GA+ D LK  + K
+Sbjct: 77  PTFQFYKNGKKVDEFSGANPDTLKEKLEK 105
+
+
+>sp|Q9DGI3|THIO_ICTPU Thioredoxin (Trx)
+ gb|AAG00612.1|AF293651_1 thioredoxin [Ictalurus punctatus]
+          Length = 107
+
+ Score = 83.2 bits (204), Expect = 4e-015
+ Identities = 47/108 (43%), Positives = 61/108 (56%), Gaps = 5/108 (4%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETL--SNDYAGKVIFLK 61
+           V+ I++  A+ A L    +  K +VVDFTATWCGPC+ I P+FETL  S DY   V+FLK
+Sbjct: 2   VVHIENLNAFSAALKNAGD--KLVVVDFTATWCGPCQKIGPIFETLSKSEDYQ-NVVFLK 58
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                         I  MPTFH YK+G K D+  GA++  LK  +  H
+Sbjct: 59  VDVDDAADVSSHCDIKCMPTFHFYKNGQKIDEFSGANEQTLKQKINDH 106
+
+
+>gb|EAU92470.1| hypothetical protein CC1G_00689 [Coprinopsis cinerea okayama7#130]
+          Length = 105
+
+ Score = 82.8 bits (203), Expect = 5e-015
+ Identities = 41/87 (47%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
+
+Query: 25  KPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHV 84
+           KP+++DF ATWCGPC++I+P+FE  S D   KV F K             G+ AMPTF V
+Sbjct: 20  KPVIIDFWATWCGPCRIISPIFEKFS-DTTDKVGFYKVDVDAQQEISQEVGVRAMPTFTV 78
+
+Query: 85  YKDGVKADDLVGASQDKLKALVAKHAA 111
+           +++G K D+LVGA   KL+ LV K +A
+Sbjct: 79  FQNGNKVDELVGAVPGKLEELVKKFSA 105
+
+
+>sp|P29449|TRXH1_TOBAC Thioredoxin H-type 1 (TRX-H1)
+ emb|CAA41415.1| thioredoxin [Nicotiana tabacum]
+          Length = 126
+
+ Score = 82.8 bits (203), Expect = 5e-015
+ Identities = 43/110 (39%), Positives = 58/110 (52%), Gaps = 1/110 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G V        W+    KG E  K +VVDFTA+WCGPC+ IAP+   ++      VIFLK
+Sbjct: 12  GQVFGCHKVEEWNEYFKKGVETKKLVVVDFTASWCGPCRFIAPILADIAKKMP-HVIFLK 70
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                         + AMPTF   KDG + D +VGA +++L+  + KHAA
+Sbjct: 71  VDVDELKTVSAEWSVEAMPTFVFIKDGKEVDRVVGAKKEELQQTIVKHAA 120
+
+
+>emb|CAC36986.1| thioredoxin h [Pisum sativum]
+          Length = 120
+
+ Score = 82.0 bits (201), Expect = 8e-015
+ Identities = 44/110 (40%), Positives = 59/110 (53%), Gaps = 1/110 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   S  AW+  L +G E  K IVVDFTA+WCGPC+ IAP    L+  +   VIFLK
+Sbjct: 8   GQVISCHSVDAWNDILHRGNESKKLIVVDFTASWCGPCRFIAPFLGELAKKFT-NVIFLK 66
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                         + AMPTF   K+G     +VGA +++L+  + +H A
+Sbjct: 67  VDVDELKSVAQDWAVEAMPTFVFVKEGTILGKVVGAKKEELQQTIERHVA 116
+
+
+>gb|ABD62163.1| thioredoxin [Schistosoma japonicum]
+          Length = 106
+
+ Score = 82.0 bits (201), Expect = 8e-015
+ Identities = 46/107 (42%), Positives = 65/107 (60%), Gaps = 4/107 (3%)
+
+Query: 3   SVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKX 62
+           +V+ I++   +D+ L + K+  K IVVDF ATWCGPCK IAP FE LS D +   +++K
+Sbjct: 3   NVLHIETDDDFDSFLKENKD--KLIVVDFFATWCGPCKKIAPAFEALSADRS--ALYVKV 58
+
+Query: 63  XXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                        +TAMPTF V K+G K D +VGAS + ++A + KH
+Sbjct: 59  DVDKLEETAKRYDVTAMPTFVVIKNGEKVDTVVGASIENVEAAIRKH 105
+
+
+>gb|ABD65296.1| thioredoxin [Solanum berthaultii]
+          Length = 123
+
+ Score = 81.6 bits (200), Expect = 1e-014
+ Identities = 44/110 (40%), Positives = 58/110 (52%), Gaps = 1/110 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI       W+ Q  KG E  K +VVDFTA+WCGPC+ IAP+   ++      VIFLK
+Sbjct: 8   GQVIGCHKVEDWEVQPQKGVETKKLVVVDFTASWCGPCRFIAPILADIAKK-MHHVIFLK 66
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                         + AMPTF   K+G + D +VGA++D L   + KH A
+Sbjct: 67  VDVDELKKVAEDWNVEAMPTFVFIKEGKEVDRVVGANKDGLLQTIEKHGA 116
+
+
+>gb|AAF66635.1|AF143404_1 thioredoxin-like protein TXL [Drosophila melanogaster]
+          Length = 287
+
+ Score = 81.3 bits (199), Expect = 1e-014
+ Identities = 45/107 (42%), Positives = 64/107 (59%), Gaps = 3/107 (2%)
+
+Query: 3   SVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKX 62
+           SV VI+ ++ + A+LA+   +   +VVDFTA+WCGPCK IAP+FET    Y  K IFLK
+Sbjct: 2   SVRVINDESHFQAELAQAGIQL--VVVDFTASWCGPCKRIAPIFETFPTKYP-KAIFLKV 58
+
+Query: 63  XXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                       G++AMPTF  Y++  K D + GA  + L+A + +H
+Sbjct: 59  DVDKCQDTAAGQGVSAMPTFIFYRNRTKIDRVQGADVNGLEAKIQEH 105
+
+
+>ref|NP_523938.2| Thioredoxin-like CG5495-PA [Drosophila melanogaster]
+ gb|AAF50750.1| CG5495-PA [Drosophila melanogaster]
+ gb|AAL90288.1| LD26837p [Drosophila melanogaster]
+          Length = 287
+
+ Score = 81.3 bits (199), Expect = 1e-014
+ Identities = 45/107 (42%), Positives = 64/107 (59%), Gaps = 3/107 (2%)
+
+Query: 3   SVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKX 62
+           SV VI+ ++ + A+LA+   +   +VVDFTA+WCGPCK IAP+FET    Y  K IFLK
+Sbjct: 2   SVRVINDESHFQAELAQAGIQL--VVVDFTASWCGPCKRIAPIFETFPTKYP-KAIFLKV 58
+
+Query: 63  XXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                       G++AMPTF  Y++  K D + GA  + L+A + +H
+Sbjct: 59  DVDKCQDTAAGQGVSAMPTFIFYRNRTKIDRVQGADVNGLEAKIQEH 105
+
+
+>emb|CAH59452.1| thioredoxin 3 [Plantago major]
+          Length = 142
+
+ Score = 81.3 bits (199), Expect = 1e-014
+ Identities = 41/106 (38%), Positives = 58/106 (54%), Gaps = 1/106 (0%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           V+   S   W       K+ +K +VVDFTATWCGPCK +AP+F  LS  Y+  V F+K
+Sbjct: 30  VMAFHSSQRWQLHFNSSKQLNKLMVVDFTATWCGPCKFMAPVFAELSTKYS-DVDFVKID 88
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                      G+ AMPTF + K G +   +VGA +D+L+  + +H
+Sbjct: 89  VDELADVAREFGVQAMPTFMLLKQGKQVGTVVGAKKDELEKKILEH 134
+
+
+>dbj|BAB25256.1| unnamed protein product [Mus musculus]
+          Length = 105
+
+ Score = 81.3 bits (199), Expect = 1e-014
+ Identities = 43/107 (40%), Positives = 63/107 (58%), Gaps = 3/107 (2%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           V +I+SK A+   LA   +  K +VVDF+ATWCGPCKMI P F +L + Y+  V+FL+
+Sbjct: 2   VKLIESKEAFQEALAAAGD--KLVVVDFSATWCGPCKMIKPFFHSLCDKYS-NVVFLEVD 58
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
+                       +  MPTF  YK G K  +  GA+++KL+A + ++A
+Sbjct: 59  VDDCQDVAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEACITEYA 105
+
+
+>ref|XP_734809.1| thioredoxin [Plasmodium chabaudi chabaudi]
+ emb|CAH82459.1| thioredoxin, putative [Plasmodium chabaudi]
+          Length = 95
+
+ Score = 80.9 bits (198), Expect = 2e-014
+ Identities = 38/89 (42%), Positives = 55/89 (61%), Gaps = 1/89 (1%)
+
+Query: 23  EHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTF 82
+           +++ ++ DF A WCGPCK IAP +E  S  Y  K++F+K              IT+MPTF
+Sbjct: 8   QNEIVIADFFADWCGPCKRIAPFYEESSKKYT-KIVFIKVNVDEASEVTEKENITSMPTF 66
+
+Query: 83  HVYKDGVKADDLVGASQDKLKALVAKHAA 111
+            VYK+GV  D L+GA++  LK L+ K+A+
+Sbjct: 67  KVYKNGVAVDTLMGANEAALKNLIEKYAS 95
+
+
+>ref|NP_035790.1| thioredoxin 1 [Mus musculus]
+ sp|P10639|THIO_MOUSE Thioredoxin (Trx) (ATL-derived factor) (ADF)
+ emb|CAA54688.1| thioredoxin [Mus musculus]
+ dbj|BAA04881.1| thioredoxin [Mus musculus]
+ dbj|BAB25096.1| unnamed protein product [Mus musculus]
+ gb|AAH10756.1| Thioredoxin 1 [Mus musculus]
+ gb|AAH94415.1| Thioredoxin 1 [Mus musculus]
+ emb|CAM21211.1| thioredoxin 1 [Mus musculus]
+          Length = 105
+
+ Score = 80.9 bits (198), Expect = 2e-014
+ Identities = 43/107 (40%), Positives = 63/107 (58%), Gaps = 3/107 (2%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           V +I+SK A+   LA   +  K +VVDF+ATWCGPCKMI P F +L + Y+  V+FL+
+Sbjct: 2   VKLIESKEAFQEALAAAGD--KLVVVDFSATWCGPCKMIKPFFHSLCDKYS-NVVFLEVD 58
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
+                       +  MPTF  YK G K  +  GA+++KL+A + ++A
+Sbjct: 59  VDDCQDVAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEASITEYA 105
+
+
+>ref|XP_724442.1| thioredoxin [Plasmodium yoelii yoelii str. 17XNL]
+ gb|EAA16007.1| thioredoxin [Plasmodium yoelii yoelii]
+          Length = 104
+
+ Score = 80.9 bits (198), Expect = 2e-014
+ Identities = 40/108 (37%), Positives = 66/108 (61%), Gaps = 5/108 (4%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           V +++S A +++ ++    +++ ++ DF A WCGPCK IAP +E  S  Y  K++F+K
+Sbjct: 2   VKIVNSLADFESAIS----QNEIVIADFFAEWCGPCKRIAPFYEESSKKYT-KIVFIKVN 56
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                       IT+MPTF VYK+GV  + L+GA++  LK L+ K+A+
+Sbjct: 57  VDEASEVTEKENITSMPTFKVYKNGVAVETLMGANEGALKNLIEKYAS 104
+
+
+>ref|NP_001055996.1| Os05g0508500 [Oryza sativa (japonica cultivar-group)]
+ gb|AAT44260.1| putative thioredoxin H-type (TRX-H) (TrxTa) [Oryza sativa (japonica
+           cultivar-group)]
+ dbj|BAF17910.1| Os05g0508500 [Oryza sativa (japonica cultivar-group)]
+ gb|EAZ34881.1| hypothetical protein OsJ_018364 [Oryza sativa (japonica
+           cultivar-group)]
+          Length = 121
+
+ Score = 80.5 bits (197), Expect = 2e-014
+ Identities = 41/110 (37%), Positives = 60/110 (54%), Gaps = 1/110 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G+VI I S   W  Q+ +     K +V+DFTA+WCGPC++IAP+F  L+  +    +FLK
+Sbjct: 12  GTVIAIHSLDEWTIQIEEANSAKKLVVIDFTASWCGPCRIIAPVFADLAKKHT-NAVFLK 70
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                         + AMPTF   K+G   D +VGA +D+L + +  H A
+Sbjct: 71  VDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAMKDELASKLELHMA 120
+
+
+>gb|AAD52699.1|AF091538_1 thioredoxin [Schistosoma japonicum]
+          Length = 106
+
+ Score = 80.5 bits (197), Expect = 2e-014
+ Identities = 45/107 (42%), Positives = 65/107 (60%), Gaps = 4/107 (3%)
+
+Query: 3   SVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKX 62
+           +V+ I++   +D+ L + K+  K IVVDF ATWCGPCK IAP FE LS D +   +++K
+Sbjct: 3   NVLHIETDDDFDSFLKENKD--KLIVVDFFATWCGPCKKIAPAFEALSADRS--ALYVKV 58
+
+Query: 63  XXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                        ++AMPTF V K+G K D +VGAS + ++A + KH
+Sbjct: 59  DVDKLEETARKYDVSAMPTFIVIKNGEKVDTVVGASIENVEAAIRKH 105
+
+
+>gb|AAN63619.1|AF435818_1 thioredoxin h-like protein [Nicotiana tabacum]
+          Length = 152
+
+ Score = 80.5 bits (197), Expect = 2e-014
+ Identities = 40/103 (38%), Positives = 61/103 (59%), Gaps = 1/103 (0%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           GG+V +I +K +WD +LA+  +E K ++ +F+A+WCGPC+MIAP +  LS  Y   ++FL
+Sbjct: 33  GGNVCLITTKESWDQKLAEANKEGKIVIANFSASWCGPCRMIAPFYCELSEKYL-SLMFL 91
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLK 103
+                          I A PTF   KD  + D LVGA++ +L+
+Sbjct: 92  TVDVDELTEFSSSWDIKATPTFFFLKDSQQIDKLVGANKPELQ 134
+
+
+>ref|NP_001075282.1| thioredoxin [Equus caballus]
+ sp|O97508|THIO_HORSE Thioredoxin (Trx)
+ dbj|BAA37154.1| thioredoxin [Equus caballus]
+          Length = 105
+
+ Score = 80.5 bits (197), Expect = 2e-014
+ Identities = 42/100 (42%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           I+SK+A+   L    E  K +VVDF+ATWCGPCKMI P F +LS  Y+  V+FL+
+Sbjct: 5   IESKSAFQEALNSAGE--KLVVVDFSATWCGPCKMIKPFFHSLSEKYS-NVVFLEVDVDD 61
+
+Query: 67  XXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                    +  MPTF  +K G K D+  GA+++KL+A +
+Sbjct: 62  CQDVAAECEVKCMPTFQFFKKGQKVDEFSGANKEKLEATI 101
+
+
+>dbj|BAB20886.1| thioredoxin h [Oryza sativa (japonica cultivar-group)]
+          Length = 121
+
+ Score = 80.5 bits (197), Expect = 2e-014
+ Identities = 41/110 (37%), Positives = 60/110 (54%), Gaps = 1/110 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G+VI I S   W  Q+ +     K +V+DFTA+WCGPC++IAP+F  L+  +    +FLK
+Sbjct: 12  GTVIAIHSLDEWTIQIEEANSAKKLVVIDFTASWCGPCRIIAPVFADLAKKHT-NAVFLK 70
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                         + AMPTF   K+G   D +VGA +D+L + +  H A
+Sbjct: 71  VDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAMKDELASKLELHMA 120
+
+
+>gb|AAF34541.1|AF202664_1 thioredoxin 1 [Plasmodium falciparum]
+          Length = 104
+
+ Score = 80.1 bits (196), Expect = 3e-014
+ Identities = 41/108 (37%), Positives = 64/108 (59%), Gaps = 5/108 (4%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           V ++ S++ +D+ ++    +++ ++VDF A WCGPCK IAP +E  S  Y  K++F+K
+Sbjct: 2   VKIVTSQSEFDSIIS----QNELVIVDFFAEWCGPCKRIAPFYEECSKTYT-KMVFIKVD 56
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                       IT+MPTF VYK+G   D L+GA+   LK L+  +AA
+Sbjct: 57  VDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEIYAA 104
+
+
+>ref|NP_446252.1| thioredoxin [Rattus norvegicus]
+ sp|P11232|THIO_RAT Thioredoxin (Trx)
+ gb|AAG49923.1|AF311055_1 thioredoxin [Rattus norvegicus]
+ emb|CAA33019.1| unnamed protein product [Rattus rattus]
+ gb|AAH58454.1| Thioredoxin 1 [Rattus norvegicus]
+          Length = 105
+
+ Score = 80.1 bits (196), Expect = 3e-014
+ Identities = 43/107 (40%), Positives = 62/107 (57%), Gaps = 3/107 (2%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           V +I+SK A+   LA   +  K +VVDF+ATWCGPCKMI P F +L + Y+  V+FL+
+Sbjct: 2   VKLIESKEAFQEALAAAGD--KLVVVDFSATWCGPCKMIKPFFHSLCDKYS-NVVFLEVD 58
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
+                       +  MPTF  YK G K  +  GA+++KL+A + + A
+Sbjct: 59  VDDCQDVAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEATITEFA 105
+
+
+>gb|EAT39951.1| conserved hypothetical protein [Aedes aegypti]
+          Length = 286
+
+ Score = 79.7 bits (195), Expect = 4e-014
+ Identities = 46/107 (42%), Positives = 61/107 (57%), Gaps = 3/107 (2%)
+
+Query: 3   SVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKX 62
+           +V  I+ +A + A+LA      K +VVDFTATWCGPC+ IAPLFE L   Y  K +FLK
+Sbjct: 2   AVKAINDEAHFQAELAAAGG--KLVVVDFTATWCGPCRNIAPLFEQLPAKYP-KAVFLKV 58
+
+Query: 63  XXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                       G++AMPTF  Y+   K D + GA  + L+A + KH
+Sbjct: 59  DVDKCSETASSQGVSAMPTFIFYRARTKIDRMQGADINGLEAKIQKH 105
+
+
+>gb|AAY42864.1| thioredoxin H [Nicotiana alata]
+          Length = 152
+
+ Score = 79.7 bits (195), Expect = 4e-014
+ Identities = 41/106 (38%), Positives = 56/106 (52%), Gaps = 1/106 (0%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           VI   S   W       K+ +K IVVDF ATWCGPCKM+ P+   +S  Y   V F+K
+Sbjct: 30  VIAFHSSNRWQLHFNSSKQLNKLIVVDFAATWCGPCKMMEPVINAMSAKYT-DVDFVKID 88
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                      G+ AMPTF + K G + + +VGA +D+L+  + KH
+Sbjct: 89  VDELSDVAQEFGVQAMPTFLLLKQGKEVERVVGAKKDELEKKILKH 134
+
+
+>ref|XP_676088.1| thioredoxin [Plasmodium berghei strain ANKA]
+ emb|CAH94443.1| thioredoxin, putative [Plasmodium berghei]
+          Length = 96
+
+ Score = 79.7 bits (195), Expect = 4e-014
+ Identities = 37/89 (41%), Positives = 55/89 (61%), Gaps = 1/89 (1%)
+
+Query: 23  EHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTF 82
+           +++ ++ DF A WCGPCK IAP +E  S  Y  K++F+K              IT+MPTF
+Sbjct: 9   QNEIVIADFFAEWCGPCKRIAPFYEESSKKYT-KIVFIKVNVDEASEVTEKENITSMPTF 67
+
+Query: 83  HVYKDGVKADDLVGASQDKLKALVAKHAA 111
+            VYK+GV  + L+GA++  LK L+ K+A+
+Sbjct: 68  KVYKNGVAVETLMGANEGALKNLIEKYAS 96
+
+
+>sp|O65049|TRXH_PICMA Thioredoxin H-type (TRX-H)
+ gb|AAC32111.1| probable thioredoxin H [Picea mariana]
+          Length = 125
+
+ Score = 79.7 bits (195), Expect = 4e-014
+ Identities = 42/110 (38%), Positives = 59/110 (53%), Gaps = 1/110 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G+V    S   W ++L +  +  + + VDFTATWCGPC++I P+F  LS  +  ++ FLK
+Sbjct: 4   GNVFACHSTEGWRSKLQEAIDTKRLVAVDFTATWCGPCRVIGPVFVELSKKFP-EIFFLK 62
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                         + AMPTF   KDG   D +VGA +D L+  VA  AA
+Sbjct: 63  VDVDELRDVAQEWDVEAMPTFIFIKDGKAVDKVVGAKKDDLERKVAALAA 112
+
+
+>gb|AAH72884.1| MGC80314 protein [Xenopus laevis]
+          Length = 105
+
+ Score = 79.3 bits (194), Expect = 5e-014
+ Identities = 41/87 (47%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
+
+Query: 16  QLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXG 75
+           QL   +   K +VVDFTATWCGPCKMIAP+FE LS D     +FLK
+Sbjct: 12  QLVLKEAGGKLVVVDFTATWCGPCKMIAPVFEKLSVDNP-DAVFLKVDVDDAQDVAAHCD 70
+
+Query: 76  ITAMPTFHVYKDGVKADDLVGASQDKL 102
+           +  MPTF  YK+G+K D+  GA+Q  L
+Sbjct: 71  VKCMPTFQFYKNGIKVDEFSGANQSSL 97
+
+
+>gb|AAN76509.1|AF352030_1 thioredoxin h [Brassica rapa]
+          Length = 133
+
+ Score = 79.3 bits (194), Expect = 5e-014
+ Identities = 42/108 (38%), Positives = 60/108 (55%), Gaps = 1/108 (0%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           V+   S A W     + KE  K +VVDF+A+WCGPC+MI P F  +S  ++  V FLK
+Sbjct: 27  VMKFSSSARWQLHFNEIKESSKLLVVDFSASWCGPCRMIEPAFIAMSAKFS-DVEFLKLD 85
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                       +T MPTF + K+G + + +VGA +D+L+  V KH A
+Sbjct: 86  VDELPDVAKEFNVTGMPTFVLVKNGKEIERIVGARKDELEKKVLKHRA 133
+
+
+>emb|CAE63862.1| Hypothetical protein CBG08424 [Caenorhabditis briggsae]
+          Length = 254
+
+ Score = 79.3 bits (194), Expect = 5e-014
+ Identities = 40/108 (37%), Positives = 62/108 (57%), Gaps = 3/108 (2%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           V+V++  + +D + +      K + VDFTA+WCGPCK IAP+F  L+N Y G V FLK
+Sbjct: 3   VVVVNGDSDFDRKFSAANG--KAVFVDFTASWCGPCKYIAPIFADLANQYKGSV-FLKVD 59
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                      G+ AMPTF  + +G K + L GA +  L+++ +K+ +
+Sbjct: 60  VDECRGTAATYGVNAMPTFIAFVNGQKKETLQGADESGLRSMCSKYGS 107
+
+
+>sp|O64394|TRXH_WHEAT Thioredoxin H-type (TRX-H) (TrxTa)
+ emb|CAA49540.1| unnamed protein product [Triticum aestivum]
+          Length = 127
+
+ Score = 79.3 bits (194), Expect = 5e-014
+ Identities = 40/110 (36%), Positives = 59/110 (53%), Gaps = 1/110 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI + S   W  Q+ +     K +V+DFTA+WCGPC+++AP+F  L+  +    +FLK
+Sbjct: 18  GEVISVHSLEQWTMQIEEANAAKKLVVIDFTASWCGPCRIMAPIFADLAKKFPA-AVFLK 76
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                         + AMPTF   K+G   D +VGA +++L   V  HAA
+Sbjct: 77  VDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTTKVGLHAA 126
+
+
+>gb|AAL24517.1|AF420472_1 thioredoxin H [Triticum aestivum]
+ emb|CAA05081.1| thioredoxin H [Triticum turgidum subsp. durum]
+          Length = 130
+
+ Score = 79.3 bits (194), Expect = 5e-014
+ Identities = 40/110 (36%), Positives = 59/110 (53%), Gaps = 1/110 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI + S   W  Q+ +     K +V+DFTA+WCGPC+++AP+F  L+  +    +FLK
+Sbjct: 21  GEVISVHSLEQWTMQIEEANAAKKLVVIDFTASWCGPCRIMAPIFADLAKKFPA-AVFLK 79
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                         + AMPTF   K+G   D +VGA +++L   V  HAA
+Sbjct: 80  VDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTTKVGLHAA 129
+
+
+>gb|EAZ10692.1| hypothetical protein OsJ_000517 [Oryza sativa (japonica
+           cultivar-group)]
+          Length = 588
+
+ Score = 79.0 bits (193), Expect = 7e-014
+ Identities = 39/107 (36%), Positives = 63/107 (58%), Gaps = 1/107 (0%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           GG+V VI +K  WD ++A+  ++ K ++ +F+A WCGPC++IAP++  +S  Y  + +FL
+Sbjct: 477 GGNVHVISNKENWDHKIAEANKDGKIVIANFSAAWCGPCRVIAPVYAEMSQTYP-QFMFL 535
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVA 107
+                          I A PTF   K+G + D LVGA++ +L+  VA
+Sbjct: 536 TIDVDELMDFSSSWDIRATPTFFFLKNGEQVDKLVGANKPELEKKVA 582
+
+
+>gb|AAN63617.1|AF435816_1 thioredoxin h-like protein [Zea mays]
+          Length = 133
+
+ Score = 79.0 bits (193), Expect = 7e-014
+ Identities = 41/113 (36%), Positives = 65/113 (57%), Gaps = 3/113 (2%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           GG+V +I S   WD ++A+   + K +V +F+A+WCGPC++IAP++  +S  Y  +++FL
+Sbjct: 20  GGNVHIITSNEGWDQKIAEANRDGKTVVANFSASWCGPCRVIAPVYAEMSKTYP-QLMFL 78
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKL--KALVAKHAA 111
+                          I A PTF   K+G + D LVGA++ +L  K L A  A+
+Sbjct: 79  TIDVDDLMDFSSSWDIRATPTFFFLKNGQQIDKLVGANKPELEKKVLAAADAS 131
+
+
+>ref|NP_001042127.1| Os01g0168200 [Oryza sativa (japonica cultivar-group)]
+ dbj|BAB39913.1| thioredoxin-like protein [Oryza sativa (japonica cultivar-group)]
+ dbj|BAB64819.1| putative thioredoxin-like protein [Oryza sativa (japonica
+           cultivar-group)]
+ dbj|BAB92503.1| putative thioredoxin-like protein [Oryza sativa (japonica
+           cultivar-group)]
+ dbj|BAF04041.1| Os01g0168200 [Oryza sativa (japonica cultivar-group)]
+          Length = 131
+
+ Score = 79.0 bits (193), Expect = 7e-014
+ Identities = 39/107 (36%), Positives = 63/107 (58%), Gaps = 1/107 (0%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           GG+V VI +K  WD ++A+  ++ K ++ +F+A WCGPC++IAP++  +S  Y  + +FL
+Sbjct: 20  GGNVHVISNKENWDHKIAEANKDGKIVIANFSAAWCGPCRVIAPVYAEMSQTYP-QFMFL 78
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVA 107
+                          I A PTF   K+G + D LVGA++ +L+  VA
+Sbjct: 79  TIDVDELMDFSSSWDIRATPTFFFLKNGEQVDKLVGANKPELEKKVA 125
+
+
+>ref|XP_001353864.1| GA18927-PA [Drosophila pseudoobscura]
+ gb|EAL29599.1| GA18927-PA [Drosophila pseudoobscura]
+          Length = 287
+
+ Score = 79.0 bits (193), Expect = 7e-014
+ Identities = 43/107 (40%), Positives = 63/107 (58%), Gaps = 3/107 (2%)
+
+Query: 3   SVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKX 62
+           +V VI+ ++ + A+LA+     + +VVDFTATWCGPC+ IAP+FE   N Y    IFLK
+Sbjct: 2   AVRVINDESHFQAELAQAGV--RLVVVDFTATWCGPCQRIAPIFELFPNKYP-NAIFLKV 58
+
+Query: 63  XXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                       G++AMPTF  Y++  K D + GA  + L+A + +H
+Sbjct: 59  DVDKCQDTAAGQGVSAMPTFIFYRNRTKIDRIQGADVNGLEAKIQEH 105
+
+
+>gb|EAY72690.1| hypothetical protein OsI_000537 [Oryza sativa (indica
+           cultivar-group)]
+          Length = 206
+
+ Score = 78.6 bits (192), Expect = 9e-014
+ Identities = 39/107 (36%), Positives = 63/107 (58%), Gaps = 1/107 (0%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           GG+V VI +K  WD ++A+  ++ K ++ +F+A WCGPC++IAP++  +S  Y  + +FL
+Sbjct: 95  GGNVHVISNKENWDHKIAEADKDGKIVIANFSAAWCGPCRVIAPVYAEMSQTYP-QFMFL 153
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVA 107
+                          I A PTF   K+G + D LVGA++ +L+  VA
+Sbjct: 154 TIDVDELMDFSSSWDIRATPTFFFLKNGEQVDKLVGANKPELEKKVA 200
+
+
+>emb|CAB96931.1| thioredoxin h [Triticum aestivum]
+ gb|AAF88067.1| thioredoxin H [Triticum aestivum]
+          Length = 125
+
+ Score = 78.6 bits (192), Expect = 9e-014
+ Identities = 40/110 (36%), Positives = 59/110 (53%), Gaps = 1/110 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI + S   W  Q+ +     K +V+DFTA+WCGPC+++AP+F  L+  +    +FLK
+Sbjct: 16  GEVISVHSLEQWTMQIEEANAAKKLVVIDFTASWCGPCRIMAPIFADLAKKFPA-AVFLK 74
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                         + AMPTF   K+G   D +VGA +++L   V  HAA
+Sbjct: 75  VDVDELKSIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTNKVGLHAA 124
+
+
+>gb|AAD49233.1|AF159388_1 thioredoxin-like protein [Phalaris coerulescens]
+ gb|AAD49234.1|AF159389_1 thioredoxin-like protein [Phalaris coerulescens]
+          Length = 131
+
+ Score = 78.6 bits (192), Expect = 9e-014
+ Identities = 39/106 (36%), Positives = 64/106 (60%), Gaps = 1/106 (0%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           GG+V VI +K  WD ++A+  ++ K +V +F+A+WCGPC++IAP++  +S  Y  +++FL
+Sbjct: 20  GGNVHVITTKEDWDQKIAEANKDGKIVVANFSASWCGPCRVIAPVYAEMSKTYP-QLMFL 78
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                          I A PTF   K+G + D LVGA++ +L+  V
+Sbjct: 79  TIDVDDLVDFSSTWDIRATPTFFFLKNGQQIDKLVGANKPELEKKV 124
+
+
+>pir||S49353 protein S2 - Phalaris coerulescens
+          Length = 281
+
+ Score = 78.6 bits (192), Expect = 9e-014
+ Identities = 39/106 (36%), Positives = 64/106 (60%), Gaps = 1/106 (0%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           GG+V VI +K  WD ++A+  ++ K +V +F+A+WCGPC++IAP++  +S  Y  +++FL
+Sbjct: 170 GGNVHVITTKEDWDQKIAEANKDGKIVVANFSASWCGPCRVIAPVYAEMSKTYP-QLMFL 228
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                          I A PTF   K+G + D LVGA++ +L+  V
+Sbjct: 229 TIDVDDLVDFSSTWDIRATPTFFFLKNGQQIDKLVGANKPELEKKV 274
+
+
+>pir||S49352 protein S1 - Phalaris coerulescens
+          Length = 282
+
+ Score = 78.6 bits (192), Expect = 9e-014
+ Identities = 39/106 (36%), Positives = 64/106 (60%), Gaps = 1/106 (0%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           GG+V VI +K  WD ++A+  ++ K +V +F+A+WCGPC++IAP++  +S  Y  +++FL
+Sbjct: 171 GGNVHVITTKEDWDQKIAEANKDGKIVVANFSASWCGPCRVIAPVYAEMSKTYP-QLMFL 229
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                          I A PTF   K+G + D LVGA++ +L+  V
+Sbjct: 230 TIDVDDLVDFSSTWDIRATPTFFFLKNGQQIDKLVGANKPELEKKV 275
+
+
+>ref|XP_315465.2| ENSANGP00000014263 [Anopheles gambiae str. PEST]
+ gb|EAA11972.3| ENSANGP00000014263 [Anopheles gambiae str. PEST]
+          Length = 286
+
+ Score = 78.6 bits (192), Expect = 9e-014
+ Identities = 41/85 (48%), Positives = 50/85 (58%), Gaps = 1/85 (1%)
+
+Query: 25  KPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHV 84
+           K +VVDFTATWCGPC+ IAPLFE L   Y  K +FLK             G++AMPTF
+Sbjct: 22  KLVVVDFTATWCGPCRNIAPLFEQLPTKYP-KAVFLKVDVDKCAETAATQGVSAMPTFIF 80
+
+Query: 85  YKDGVKADDLVGASQDKLKALVAKH 109
+           Y+   K D L GA  + L+A + KH
+Sbjct: 81  YRARTKIDRLQGADINGLEAKIQKH 105
+
+
+>gb|AAI29795.1| Unknown (protein for MGC:160515) [Xenopus laevis]
+          Length = 105
+
+ Score = 78.2 bits (191), Expect = 1e-013
+ Identities = 40/86 (46%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
+
+Query: 23  EHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTF 82
+           + K +VVDFTATWCGPCKMIAP+FE LS +    V+FLK              +  MPTF
+Sbjct: 19  KEKLVVVDFTATWCGPCKMIAPVFEKLSVENP-DVVFLKVDVDDAQDVAAHCEVKCMPTF 77
+
+Query: 83  HVYKDGVKADDLVGASQDKLKALVAK 108
+           H YK+G+K  +  GA++  L   VA+
+Sbjct: 78  HFYKNGLKVFEFSGANESSLVQKVAE 103
+
+
+>gb|AAD49230.1|AF159385_1 thioredoxin-like protein [Hordeum bulbosum]
+          Length = 131
+
+ Score = 78.2 bits (191), Expect = 1e-013
+ Identities = 39/106 (36%), Positives = 64/106 (60%), Gaps = 1/106 (0%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           GG+V VI +K  WD ++A+  ++ K +V +F+A+WCGPC++IAP++  +S  Y  +++FL
+Sbjct: 20  GGNVHVITTKEDWDQKVAEANKDGKIVVANFSASWCGPCRVIAPVYAEMSKTYP-QLMFL 78
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                          I A PTF   K+G + D LVGA++ +L+  V
+Sbjct: 79  TIDVDDLMDFGSTWDIRATPTFFFLKNGQQIDKLVGANKPELEKKV 124
+
+
+>gb|AAP72291.1| thioredoxin h isoform 2; HvTrxh2 [Hordeum vulgare subsp. vulgare]
+          Length = 122
+
+ Score = 78.2 bits (191), Expect = 1e-013
+ Identities = 40/108 (37%), Positives = 59/108 (54%), Gaps = 1/108 (0%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           VI + S   W  Q+ +     K +V+DFTA+WCGPC+++AP+F  L+  +    +FLK
+Sbjct: 14  VISVHSLEQWTMQIEEANTAKKLVVIDFTASWCGPCRIMAPVFADLAKKFP-NAVFLKVD 72
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                       + AMPTF   K+G   D +VGA +++L A V  HAA
+Sbjct: 73  VDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTAKVGLHAA 120
+
+
+>ref|XP_001353205.1| GA12311-PA [Drosophila pseudoobscura]
+ gb|EAL30707.1| GA12311-PA [Drosophila pseudoobscura]
+          Length = 131
+
+ Score = 78.2 bits (191), Expect = 1e-013
+ Identities = 38/105 (36%), Positives = 63/105 (60%), Gaps = 2/105 (1%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           VIV++SK  ++  + +   +H  ++V+F ATWCGPC +I P  E ++N+YAG++I LK
+Sbjct: 8   VIVVESKTNFENIIGEAGNKH--VLVEFFATWCGPCALIGPRLEQMANEYAGRMIILKID 65
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAK 108
+                       IT+MPTF + K+ V     VG++ +K+++ V K
+Sbjct: 66  VDDHEELAVEYEITSMPTFLIIKNKVTLTQFVGSNAEKVESNVVK 110
+
+
+>ref|XP_001398799.1| hypothetical protein An18g03380 [Aspergillus niger]
+ emb|CAK48723.1| unnamed protein product [Aspergillus niger]
+          Length = 106
+
+ Score = 77.8 bits (190), Expect = 2e-013
+ Identities = 40/85 (47%), Positives = 49/85 (57%), Gaps = 1/85 (1%)
+
+Query: 27  IVVDFTATWCGPCKMIAPLFETL-SNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHVY 85
+           +++DF ATWCGPCKMI+P FE L S      + F K             GI AMPTF V+
+Sbjct: 22  VIIDFWATWCGPCKMISPFFEQLASRPEFSAIKFAKVDVDTQEDISQECGIRAMPTFIVF 81
+
+Query: 86  KDGVKADDLVGASQDKLKALVAKHA 110
+           KDG K DD+ GA    L+ LV K+A
+Sbjct: 82  KDGQKLDDMAGAHPGGLQGLVQKYA 106
+
+
+>gb|AAL79841.1|AF473536_1 thioredoxin [Schistosoma mansoni]
+          Length = 106
+
+ Score = 77.8 bits (190), Expect = 2e-013
+ Identities = 43/103 (41%), Positives = 59/103 (57%), Gaps = 2/103 (1%)
+
+Query: 6   VIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXX 65
+           +I+ K   D +    + ++K +VVDF ATWCGPCK IAPLF+ LS  Y    IF+K
+Sbjct: 4   LIELKQDGDLESLLEQHKNKLVVVDFFATWCGPCKTIAPLFKELSEKY--DAIFVKVDVD 61
+
+Query: 66  XXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAK 108
+                     I+AMPTF   K+G K  D+VGAS  K++ ++ K
+Sbjct: 62  KLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKK 104
+
+
+>gb|AAO12855.1| thioredoxin h [Pisum sativum]
+          Length = 130
+
+ Score = 77.8 bits (190), Expect = 2e-013
+ Identities = 38/109 (34%), Positives = 61/109 (55%), Gaps = 1/109 (0%)
+
+Query: 3   SVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKX 62
+           +V    S A W     + K+  + +V+DF+ATWCGPCKM+ P+   ++N++   V F+K
+Sbjct: 23  AVKTFHSSARWQLHFNEIKDSPRLVVIDFSATWCGPCKMMEPIVYAMANEFT-DVEFIKI 81
+
+Query: 63  XXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                        + AMPTF + K+G + D +VGA +D+LK  + K+ A
+Sbjct: 82  DVDELSDVAQEFKVQAMPTFLLLKNGEEVDKIVGAKKDELKNKIKKYRA 130
+
+
+>gb|AAG35777.1|AF273844_1 thioredoxin-h-like protein 1 [Brassica oleracea var. alboglabra]
+          Length = 116
+
+ Score = 77.8 bits (190), Expect = 2e-013
+ Identities = 40/109 (36%), Positives = 60/109 (55%), Gaps = 1/109 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   +   W+ +L   KE +K IV+DFTA WC PC+ IAP+F  L+  +   V+F K
+Sbjct: 4   GEVIACHTVEDWNNKLKAAKESNKLIVIDFTAVWCPPCRFIAPIFVELAKKHL-DVVFFK 62
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
+                         + AMPTF   K   K D +VGA++++++A + KH+
+Sbjct: 63  VDVDELATVAQEFDVQAMPTFVYMKGEEKLDKVVGAAKEEIEAKLLKHS 111
+
+
+>sp|O64432|TRXH_BRARA Thioredoxin H-type (TRX-H)
+ dbj|BAA25681.1| Thioredoxin [Brassica rapa]
+          Length = 123
+
+ Score = 77.8 bits (190), Expect = 2e-013
+ Identities = 40/109 (36%), Positives = 60/109 (55%), Gaps = 1/109 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   +   W+ +L   KE +K IV+DFTA WC PC+ IAP+F  L+  +   V+F K
+Sbjct: 11  GEVIACHTVEDWNNKLKAAKESNKLIVIDFTAVWCPPCRFIAPIFVELAKKHL-DVVFFK 69
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
+                         + AMPTF   K   K D +VGA++++++A + KH+
+Sbjct: 70  VDVDELATVAKEFDVQAMPTFVYMKGEEKLDKVVGAAKEEIEAKLLKHS 118
+
+
+>sp|P68176|TRXH_BRAOL Thioredoxin H-type (TRX-H) (Pollen coat protein)
+ sp|P68177|TRXH1_BRANA Thioredoxin H-type 1 (TRX-H-1)
+ emb|CAA61908.1| pollen coat protein [Brassica oleracea]
+ gb|AAB53694.1| thioredoxin-h-like-1
+          Length = 123
+
+ Score = 77.8 bits (190), Expect = 2e-013
+ Identities = 40/109 (36%), Positives = 60/109 (55%), Gaps = 1/109 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   +   W+ +L   KE +K IV+DFTA WC PC+ IAP+F  L+  +   V+F K
+Sbjct: 11  GEVIACHTVEDWNNKLKAAKESNKLIVIDFTAVWCPPCRFIAPIFVELAKKHL-DVVFFK 69
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
+                         + AMPTF   K   K D +VGA++++++A + KH+
+Sbjct: 70  VDVDELATVAQEFDVQAMPTFVYMKGEEKLDKVVGAAKEEIEAKLLKHS 118
+
+
+>ref|XP_001083928.1| PREDICTED: thioredoxin [Macaca mulatta]
+          Length = 105
+
+ Score = 77.4 bits (189), Expect = 2e-013
+ Identities = 42/100 (42%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           I+SKAA+  Q A      K +VVDF+ATWCGPCKMI P F +LS  Y+  V+FL+
+Sbjct: 5   IESKAAF--QEALNTTGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYS-NVVFLEVDVDD 61
+
+Query: 67  XXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                    +  MPTF  +K G K  +  GA+++KL+A +
+Sbjct: 62  CQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATI 101
+
+
+>ref|XP_001113950.1| PREDICTED: thioredoxin [Macaca mulatta]
+          Length = 105
+
+ Score = 77.4 bits (189), Expect = 2e-013
+ Identities = 41/100 (41%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           I+SKAA+   L    +  K +VVDF+ATWCGPCKMI P F +LS  Y+  V+FL+
+Sbjct: 5   IESKAAFQEALNTAGD--KLVVVDFSATWCGPCKMIKPFFHSLSEKYS-NVVFLEVDVDD 61
+
+Query: 67  XXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                    +  MPTF  +K G K  +  GA+++KL+A +
+Sbjct: 62  CQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATI 101
+
+
+>gb|AAB01771.1| thioredoxin homolog
+          Length = 98
+
+ Score = 77.4 bits (189), Expect = 2e-013
+ Identities = 38/85 (44%), Positives = 50/85 (58%), Gaps = 1/85 (1%)
+
+Query: 25  KPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHV 84
+           K +V DFTA+WCGPC+ I+P+F  +S  Y   V FLK             GI AMPTF
+Sbjct: 12  KLVVADFTASWCGPCQYISPIFAAMSTQYE-DVKFLKIDVDECQDIALEYGIEAMPTFQF 70
+
+Query: 85  YKDGVKADDLVGASQDKLKALVAKH 109
+           +K+G K D++ GA  D L+ LV K+
+Sbjct: 71  FKNGTKVDEVQGADPDSLEQLVKKY 95
+
+
+>ref|NP_001036197.1| thioredoxin [Macaca mulatta]
+ sp|P29451|THIO_MACMU Thioredoxin (Trx)
+ gb|AAA36921.1| thioredoxin
+          Length = 105
+
+ Score = 77.4 bits (189), Expect = 2e-013
+ Identities = 41/100 (41%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           I+SKAA+   L    +  K +VVDF+ATWCGPCKMI P F +LS  Y+  V+FL+
+Sbjct: 5   IESKAAFQEALDDAGD--KLVVVDFSATWCGPCKMIKPFFHSLSEKYS-NVVFLEVDVDD 61
+
+Query: 67  XXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                    +  MPTF  +K G K  +  GA+++KL+A +
+Sbjct: 62  CQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATI 101
+
+
+>ref|NP_593852.1| hypothetical protein SPAC7D4.07c [Schizosaccharomyces pombe 972h-]
+ sp|O14463|THIO_SCHPO Thioredoxin (TR)
+ gb|AAF76881.1|AF251279_1 thioredoxin [Schizosaccharomyces pombe]
+ emb|CAB16724.1| SPAC7D4.07c [Schizosaccharomyces pombe]
+ emb|CAA06033.1| thioredoxine 2 [Schizosaccharomyces pombe]
+          Length = 103
+
+ Score = 77.4 bits (189), Expect = 2e-013
+ Identities = 38/84 (45%), Positives = 52/84 (61%), Gaps = 1/84 (1%)
+
+Query: 23  EHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTF 82
+           + K +VVDF ATWCGPCK IAP FE  SN Y+    F+K             G+ AMP+F
+Sbjct: 17  QDKLVVVDFFATWCGPCKAIAPKFEQFSNTYS-DATFIKVDVDQLSEIAAEAGVHAMPSF 75
+
+Query: 83  HVYKDGVKADDLVGASQDKLKALV 106
+            +YK+G K +++VGA+  KL+A +
+Sbjct: 76  FLYKNGEKIEEIVGANPAKLEASI 99
+
+
+>gb|AAD49232.1|AF159387_1 thioredoxin-like protein [Lolium perenne]
+          Length = 131
+
+ Score = 77.0 bits (188), Expect = 3e-013
+ Identities = 39/106 (36%), Positives = 63/106 (59%), Gaps = 1/106 (0%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           GG+V VI +K  WD ++A+  ++ K +V +F+A+WCGPC++IAP++  +S  Y  +++FL
+Sbjct: 20  GGNVHVITTKEDWDQKVAEANKDGKIVVANFSASWCGPCRVIAPVYAEMSKTYP-QLMFL 78
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                          I A PTF   K+G   D LVGA++ +L+  V
+Sbjct: 79  TIDVDDLMDFSSTWDIRATPTFFFLKNGQLIDKLVGANRPELEKKV 124
+
+
+>ref|NP_001009421.1| thioredoxin [Ovis aries]
+ sp|P50413|THIO_SHEEP Thioredoxin (Trx)
+ emb|CAA81083.1| thioredoxin [Ovis aries]
+          Length = 105
+
+ Score = 77.0 bits (188), Expect = 3e-013
+ Identities = 41/100 (41%), Positives = 57/100 (57%), Gaps = 3/100 (3%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           I+SK A+   L    E  K +VVDF+ATWCGPCKMI P F +LS  Y+  V+FL+
+Sbjct: 5   IESKYAFQEALNSAGE--KLVVVDFSATWCGPCKMIKPFFHSLSEKYS-NVVFLEVDVDD 61
+
+Query: 67  XXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                    +  MPTF  +K G K  +  GA+++KL+A +
+Sbjct: 62  CQDVAAECEVKCMPTFQFFKKGQKVSEFSGANKEKLEATI 101
+
+
+>ref|XP_747097.1| thioredoxin, putative [Aspergillus fumigatus Af293]
+ gb|EAL85059.1| thioredoxin, putative [Aspergillus fumigatus Af293]
+          Length = 116
+
+ Score = 77.0 bits (188), Expect = 3e-013
+ Identities = 39/83 (46%), Positives = 51/83 (61%), Gaps = 1/83 (1%)
+
+Query: 25  KPIVVDFTATWCGPCKMIAPLFETLS-NDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFH 83
+           KP+V+DF ATWCGPCK I+PLFE +S N   G V F K             GI AMPTF
+Sbjct: 28  KPVVIDFWATWCGPCKAISPLFEKMSDNPEYGNVGFYKVDVDEQEQVSQEVGIRAMPTFV 87
+
+Query: 84  VYKDGVKADDLVGASQDKLKALV 106
+           ++K+G K  + VGA+  +L+ L+
+Sbjct: 88  LFKNGYKIGEAVGAAPPRLEGLL 110
+
+
+>gb|AAN63616.1|AF435815_1 thioredoxin h-like protein [Hordeum vulgare subsp. vulgare]
+          Length = 131
+
+ Score = 76.6 bits (187), Expect = 4e-013
+ Identities = 38/106 (35%), Positives = 63/106 (59%), Gaps = 1/106 (0%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           GG+V VI +K  WD ++ +  ++ K +V +F+A+WCGPC++IAP++  +S  Y  +++FL
+Sbjct: 20  GGNVHVITTKEDWDQKIEEANKDGKIVVANFSASWCGPCRVIAPVYAEMSKTYP-QLMFL 78
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                          I A PTF   K+G + D LVGA++ +L+  V
+Sbjct: 79  TIDVDDLMDFSSTWDIRATPTFFFLKNGQQIDKLVGANKPELEKKV 124
+
+
+>gb|AAO16555.1| thioredoxin h [Leymus chinensis]
+          Length = 131
+
+ Score = 76.6 bits (187), Expect = 4e-013
+ Identities = 38/106 (35%), Positives = 63/106 (59%), Gaps = 1/106 (0%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           GG+V VI +K  WD ++ +  ++ K +V +F+A+WCGPC++IAP++  +S  Y  +++FL
+Sbjct: 20  GGNVHVITTKEDWDQKIEEANKDGKIVVANFSASWCGPCRVIAPVYAEMSKTYP-QLMFL 78
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                          I A PTF   K+G + D LVGA++ +L+  V
+Sbjct: 79  TIDVDDLMDFSSTWDIRATPTFFFLKNGQQIDKLVGANKPELEKKV 124
+
+
+>ref|NP_187483.1| ATH9 (thioredoxin H-type 9); thiol-disulfide exchange intermediate
+           [Arabidopsis thaliana]
+ ref|NP_001078124.1| ATH9 (thioredoxin H-type 9) [Arabidopsis thaliana]
+ gb|AAG51342.1|AC012562_3 thioredoxin-like protein; 56513-57227 [Arabidopsis thaliana]
+ gb|AAS49091.1| At3g08710 [Arabidopsis thaliana]
+ dbj|BAE98817.1| thioredoxin-like protein [Arabidopsis thaliana]
+          Length = 140
+
+ Score = 76.6 bits (187), Expect = 4e-013
+ Identities = 40/106 (37%), Positives = 62/106 (58%), Gaps = 1/106 (0%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           GG+V +I +K +WD +LA+   + K +V +F+ATWCGPCK++AP F  LS  ++  ++FL
+Sbjct: 22  GGNVHLITTKESWDDKLAEADRDGKIVVANFSATWCGPCKIVAPFFIELSEKHS-SLMFL 80
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                          I A PTF   K+G +   LVGA++ +L+  V
+Sbjct: 81  LVDVDELSDFSSSWDIKATPTFFFLKNGQQIGKLVGANKPELQKKV 126
+
+
+>dbj|BAE56042.1| unnamed protein product [Aspergillus oryzae]
+          Length = 109
+
+ Score = 76.6 bits (187), Expect = 4e-013
+ Identities = 39/88 (44%), Positives = 52/88 (59%), Gaps = 1/88 (1%)
+
+Query: 25  KPIVVDFTATWCGPCKMIAPLFETLSN-DYAGKVIFLKXXXXXXXXXXXXXGITAMPTFH 83
+           KP+++DF ATWCGPC+ I+P+FE +SN +    V F K             GI AMPTF
+Sbjct: 20  KPVLIDFWATWCGPCRAISPVFEEMSNAEGFDNVGFYKVDVDAQEQIAQEVGIRAMPTFM 79
+
+Query: 84  VYKDGVKADDLVGASQDKLKALVAKHAA 111
+           ++++G K  DLVGA+   L  LV K  A
+Sbjct: 80  LFRNGAKVGDLVGANSQGLTELVKKATA 107
+
+
+>ref|NP_776393.1| thioredoxin [Bos taurus]
+ sp|O97680|THIO_BOVIN Thioredoxin (Trx)
+ gb|AAC83380.1| thioredoxin [Bos taurus]
+ gb|AAI03416.1| Thioredoxin [Bos taurus]
+ gb|AAI20458.1| Thioredoxin [Bos taurus]
+          Length = 105
+
+ Score = 76.6 bits (187), Expect = 4e-013
+ Identities = 41/100 (41%), Positives = 57/100 (57%), Gaps = 3/100 (3%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           I+SK A+   L    E  K +VVDF+ATWCGPCKMI P F +LS  Y+  V+FL+
+Sbjct: 5   IESKYAFQEALNSAGE--KLVVVDFSATWCGPCKMIKPFFHSLSEKYS-NVVFLEVDVDD 61
+
+Query: 67  XXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                    +  MPTF  +K G K  +  GA+++KL+A +
+Sbjct: 62  CQDVAAECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATI 101
+
+
+>sp|Q9BDJ3|THIO_CALJA Thioredoxin (Trx)
+ gb|AAK30295.1|AF353204_1 thioredoxin [Callithrix jacchus]
+          Length = 105
+
+ Score = 76.6 bits (187), Expect = 4e-013
+ Identities = 41/100 (41%), Positives = 57/100 (57%), Gaps = 3/100 (3%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           IDSK A+   L    +  K +VVDF+ATWCGPCKMI P F +LS  Y+  V+FL+
+Sbjct: 5   IDSKDAFQEALDAAGD--KLVVVDFSATWCGPCKMIKPFFHSLSEKYS-NVVFLEVDVDD 61
+
+Query: 67  XXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                    +  MPTF  +K G K  +  GA+++KL+A +
+Sbjct: 62  CQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATI 101
+
+
+>ref|NP_999478.1| thioredoxin [Sus scrofa]
+ sp|P82460|THIO_PIG Thioredoxin (Trx)
+ gb|AAK60272.1|AF382821_1 thioredoxin [Sus scrofa]
+          Length = 105
+
+ Score = 76.6 bits (187), Expect = 4e-013
+ Identities = 41/100 (41%), Positives = 57/100 (57%), Gaps = 3/100 (3%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           I+SK A+   L    E  K +VVDF+ATWCGPCKMI P F +LS  Y+  V+FL+
+Sbjct: 5   IESKYAFQEALNSAGE--KLVVVDFSATWCGPCKMIKPFFHSLSEKYS-NVVFLEVDVDD 61
+
+Query: 67  XXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                    +  MPTF  +K G K  +  GA+++KL+A +
+Sbjct: 62  CQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATI 101
+
+
+>pdb|1ERV|  Chain  , Human Thioredoxin Mutant With Cys 73 Replaced By Ser
+           (Reduced Form)
+ pdb|2HSH|A unnamed protein product [Homo sapiens]
+          Length = 105
+
+ Score = 76.6 bits (187), Expect = 4e-013
+ Identities = 41/100 (41%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           I+SK A+   L    +  K +VVDF+ATWCGPCKMI P F +LS  Y+  VIFL+
+Sbjct: 5   IESKTAFQEALDAAGD--KLVVVDFSATWCGPCKMIKPFFHSLSEKYS-NVIFLEVDVDD 61
+
+Query: 67  XXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                    + +MPTF  +K G K  +  GA+++KL+A +
+Sbjct: 62  CQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATI 101
+
+
+>ref|XP_760726.1| hypothetical protein UM04579.1 [Ustilago maydis 521]
+ gb|EAK85553.1| hypothetical protein UM04579.1 [Ustilago maydis 521]
+          Length = 952
+
+ Score = 76.6 bits (187), Expect = 4e-013
+ Identities = 44/106 (41%), Positives = 61/106 (57%), Gaps = 5/106 (4%)
+
+Query: 7   IDSKAAWDAQL-AKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXX 65
+           + S   +DA+L A G    K +VVDF ATWCGPCK+IAP+F+ L++ Y   V+FLK
+Sbjct: 5   VSSAVEFDAELNAAGS---KLVVVDFHATWCGPCKVIAPIFQRLASQYT-SVVFLKVDVD 60
+
+Query: 66  XXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                     + AMPTF   K+    D L GA  ++L ALV +H++
+Sbjct: 61  RVQPVAQRYSVCAMPTFLFLKNKSVVDTLQGADPNRLTALVKQHSS 106
+
+
+>pdb|2HXK|A Chain A, Crystal Structure Of S-Nitroso Thioredoxin
+ pdb|2HXK|B Chain B, Crystal Structure Of S-Nitroso Thioredoxin
+ pdb|2HXK|C Chain C, Crystal Structure Of S-Nitroso Thioredoxin
+ pdb|2IIY|A unnamed protein product [Homo sapiens]
+          Length = 105
+
+ Score = 76.3 bits (186), Expect = 5e-013
+ Identities = 43/100 (43%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           I+SK A+   L    +  K +VVDF+ATWCGPCKMI P F +LS  Y+  VIFL+
+Sbjct: 5   IESKTAFQEALDAAGD--KLVVVDFSATWCGPCKMIKPFFHSLSEKYS-NVIFLEVDVDD 61
+
+Query: 67  XXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                    +  MPTF  +K G K  +  GA+++KL+A +
+Sbjct: 62  XQDVASEXEVKCMPTFQFFKKGQKVGEFSGANKEKLEATI 101
+
+
+>pdb|2IFQ|A Chain A, Crystal Structure Of S-Nitroso Thioredoxin
+ pdb|2IFQ|C Chain C, Crystal Structure Of S-Nitroso Thioredoxin
+          Length = 105
+
+ Score = 76.3 bits (186), Expect = 5e-013
+ Identities = 42/100 (42%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           I+SK A+   L    +  K +VVDF+ATWCGPCKMI P F +LS  Y+  VIFL+
+Sbjct: 5   IESKTAFQEALDAAGD--KLVVVDFSATWCGPCKMIKPFFHSLSEKYS-NVIFLEVDVDD 61
+
+Query: 67  XXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                    +  MPTF  +K G K  +  GA+++KL+A +
+Sbjct: 62  CQDVASEXEVKCMPTFQFFKKGQKVGEFSGANKEKLEATI 101
+
+
+>ref|XP_001142154.1| PREDICTED: similar to Thioredoxin (ATL-derived factor) (ADF)
+           (Surface-associated sulphydryl protein) (SASP) [Pan
+           troglodytes]
+          Length = 323
+
+ Score = 76.3 bits (186), Expect = 5e-013
+ Identities = 41/100 (41%), Positives = 57/100 (57%), Gaps = 3/100 (3%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           I+SK A+   L    +  K +VVDF+ATWCGPCKMI P F +LS  Y+  VIFL+
+Sbjct: 223 IESKTAFQEALDAAGD--KLVVVDFSATWCGPCKMIKPFFHSLSEKYS-NVIFLEVDVDD 279
+
+Query: 67  XXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                    +  MPTF  +K G K  +  GA+++KL+A +
+Sbjct: 280 CQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATI 319
+
+
+>gb|AAP36296.1| Homo sapiens thioredoxin [synthetic construct]
+ gb|AAX43691.1| thioredoxin [synthetic construct]
+          Length = 106
+
+ Score = 76.3 bits (186), Expect = 5e-013
+ Identities = 41/100 (41%), Positives = 57/100 (57%), Gaps = 3/100 (3%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           I+SK A+   L    +  K +VVDF+ATWCGPCKMI P F +LS  Y+  VIFL+
+Sbjct: 5   IESKTAFQEALDAAGD--KLVVVDFSATWCGPCKMIKPFFHSLSEKYS-NVIFLEVDVDD 61
+
+Query: 67  XXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                    +  MPTF  +K G K  +  GA+++KL+A +
+Sbjct: 62  CQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATI 101
+
+
+>ref|NP_003320.2| thioredoxin [Homo sapiens]
+ sp|P10599|THIO_HUMAN Thioredoxin (Trx) (ATL-derived factor) (ADF) (Surface-associated
+           sulphydryl protein) (SASP)
+ pdb|1ERT|  Chain  , Human Thioredoxin (Reduced Form)
+ pdb|1ERU|  Chain  , Human Thioredoxin (Oxidized Form)
+ pdb|1AUC|  Chain  , Human Thioredoxin (Oxidized With Diamide)
+ pdb|2IFQ|B Chain B, Crystal Structure Of S-Nitroso Thioredoxin
+ gb|AAG34699.1|AF313911_1 thioredoxin [Homo sapiens]
+ emb|CAA54687.1| ATL-derived factor/thioredoxin [Homo sapiens]
+ emb|CAA38410.1| thioredoxin [Homo sapiens]
+ gb|AAF87085.1| thioredoxin [Homo sapiens]
+ gb|AAH03377.1| Thioredoxin [Homo sapiens]
+ gb|AAN33187.1| thioredoxin [Homo sapiens]
+ gb|AAH54866.1| Thioredoxin [Homo sapiens]
+ emb|CAG28593.1| TXN [Homo sapiens]
+ emb|CAI14066.1| thioredoxin [Homo sapiens]
+ gb|EAW59059.1| thioredoxin, isoform CRA_a [Homo sapiens]
+          Length = 105
+
+ Score = 76.3 bits (186), Expect = 5e-013
+ Identities = 41/100 (41%), Positives = 57/100 (57%), Gaps = 3/100 (3%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           I+SK A+   L    +  K +VVDF+ATWCGPCKMI P F +LS  Y+  VIFL+
+Sbjct: 5   IESKTAFQEALDAAGD--KLVVVDFSATWCGPCKMIKPFFHSLSEKYS-NVIFLEVDVDD 61
+
+Query: 67  XXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                    +  MPTF  +K G K  +  GA+++KL+A +
+Sbjct: 62  CQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATI 101
+
+
+>pdb|1AIU|  Chain  , Human Thioredoxin (D60n Mutant, Reduced Form)
+          Length = 105
+
+ Score = 76.3 bits (186), Expect = 5e-013
+ Identities = 41/100 (41%), Positives = 57/100 (57%), Gaps = 3/100 (3%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           I+SK A+   L    +  K +VVDF+ATWCGPCKMI P F +LS  Y+  VIFL+
+Sbjct: 5   IESKTAFQEALDAAGD--KLVVVDFSATWCGPCKMIKPFFHSLSEKYS-NVIFLEVDVND 61
+
+Query: 67  XXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                    +  MPTF  +K G K  +  GA+++KL+A +
+Sbjct: 62  CQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATI 101
+
+
+>ref|NP_001078175.1| ATTDX (TETRATICOPEPTIDE DOMAIN-CONTAINING THIOREDOXIN) [Arabidopsis
+           thaliana]
+          Length = 373
+
+ Score = 75.9 bits (185), Expect = 6e-013
+ Identities = 36/110 (32%), Positives = 65/110 (59%), Gaps = 1/110 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI I S +  +A+    K+  + +++ FTATWCGPC+ ++PL+  L+  ++ +V+FLK
+Sbjct: 263 GEVISIHSTSELEAKTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHS-RVVFLK 321
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                         I+++PTF   +DG + D +VGA +  L+  +A+H++
+Sbjct: 322 VDIDKANDVAASWNISSVPTFCFIRDGKEVDKVVGADKGSLEQKIAQHSS 371
+
+
+>gb|ABO83980.1| Thioredoxin domain 2; Thioredoxin fold [Medicago truncatula]
+          Length = 364
+
+ Score = 75.9 bits (185), Expect = 6e-013
+ Identities = 36/109 (33%), Positives = 64/109 (58%), Gaps = 1/109 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI + S    + +L+   +  + +V+ FTATWCGPC+ I+PL+ +L+  Y  +V+FLK
+Sbjct: 254 GQVIGVHSVGELETKLSAASKTSRLLVLYFTATWCGPCRYISPLYTSLAEKYQ-RVVFLK 312
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
+                         ++++PTF   K+G + D +VGA ++ L+  +A+H+
+Sbjct: 313 VDIDEAVDVAARWNVSSVPTFFFVKNGKEVDSVVGADKNTLERKIAQHS 361
+
+
+>ref|XP_001261730.1| thioredoxin, putative [Neosartorya fischeri NRRL 181]
+ gb|EAW19833.1| thioredoxin, putative [Neosartorya fischeri NRRL 181]
+          Length = 109
+
+ Score = 75.9 bits (185), Expect = 6e-013
+ Identities = 38/83 (45%), Positives = 52/83 (62%), Gaps = 1/83 (1%)
+
+Query: 25  KPIVVDFTATWCGPCKMIAPLFETLS-NDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFH 83
+           KP+++DF ATWCGPC+ I+P+FE LS N   G V F K             GI AMPTF
+Sbjct: 20  KPVIIDFWATWCGPCRAISPIFEQLSDNPDFGDVGFYKVDVDEQEQISQEVGIRAMPTFV 79
+
+Query: 84  VYKDGVKADDLVGASQDKLKALV 106
+           ++K+G K  +L+GA   +L+AL+
+Sbjct: 80  LFKNGDKVGELMGAVPQRLQALL 102
+
+
+>gb|ABC75102.1| thioredoxin [Cryphonectria parasitica]
+          Length = 117
+
+ Score = 75.9 bits (185), Expect = 6e-013
+ Identities = 39/85 (45%), Positives = 50/85 (58%), Gaps = 3/85 (3%)
+
+Query: 27  IVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHVYK 86
+           + VD+ ATWCGPCKMIAP     SN+Y G V F+K              + AMPTFHV+K
+Sbjct: 22  VFVDWFATWCGPCKMIAPKIAEWSNEYTG-VYFVKIDVDALPELAAEHNVKAMPTFHVFK 80
+
+Query: 87  DG--VKADDLVGASQDKLKALVAKH 109
+           DG    A++ V A   K++AL+ KH
+Sbjct: 81  DGNTTAAEEFVSAVPPKVQALIEKH 105
+
+
+>gb|AAP88338.1| At3g17880 [Arabidopsis thaliana]
+          Length = 123
+
+ Score = 75.9 bits (185), Expect = 6e-013
+ Identities = 36/110 (32%), Positives = 65/110 (59%), Gaps = 1/110 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI I S +  +A+    K+  + +++ FTATWCGPC+ ++PL+  L+  ++ +V+FLK
+Sbjct: 13  GEVISIHSTSELEAKTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHS-RVVFLK 71
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                         I+++PTF   +DG + D +VGA +  L+  +A+H++
+Sbjct: 72  VDIDKANDVAASWNISSVPTFCFIRDGKEVDKVVGADKGSLEQKIAQHSS 121
+
+
+>gb|AAD49231.1|AF159386_1 thioredoxin-like protein [Secale cereale]
+          Length = 131
+
+ Score = 75.9 bits (185), Expect = 6e-013
+ Identities = 37/106 (34%), Positives = 63/106 (59%), Gaps = 1/106 (0%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           GG+V VI +K  WD ++ +  ++ K +V +F+A+WCGPC+++AP++  +S  Y  +++FL
+Sbjct: 20  GGNVHVITTKEDWDQKIEEANKDGKIVVANFSASWCGPCRVVAPVYAGMSKTYP-QLMFL 78
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                          I A PTF   K+G + D LVGA++ +L+  V
+Sbjct: 79  TIDVDDLMDFSSTWDIRATPTFFFLKNGQQIDKLVGANKPELEKKV 124
+
+
+>emb|CAH59450.1| thioredoxin 1 [Plantago major]
+          Length = 119
+
+ Score = 75.9 bits (185), Expect = 6e-013
+ Identities = 42/108 (38%), Positives = 55/108 (50%), Gaps = 1/108 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G V  + S   +   L K KE  K +V+DFTA+WCGPC+ IAP+   L+      V+FLK
+Sbjct: 8   GQVYSVHSVEEFKDHLEKSKEAKKLVVIDFTASWCGPCRFIAPILAELAKK-TPHVMFLK 66
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                         + AMPTF   KDG   D LVGA ++ L A +  H
+Sbjct: 67  VDVDELKAISVEYEVEAMPTFVFLKDGKPIDRLVGAKKEDLLAKITTH 114
+
+
+>sp|Q6XHI1|THIO2_DROYA Thioredoxin-2
+ gb|AAR10225.1| similar to Drosophila melanogaster thioredoxin [Drosophila yakuba]
+          Length = 106
+
+ Score = 75.9 bits (185), Expect = 6e-013
+ Identities = 41/103 (39%), Positives = 56/103 (54%), Gaps = 2/103 (1%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           V  I  KA  + QL K     K +V+DF ATWCGPCKMI+P    LS  YA  V+ LK
+Sbjct: 2   VYQIKDKADLNGQLTKASG--KLVVLDFFATWCGPCKMISPKLAELSTQYADTVVVLKVD 59
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                       I++MPTF   K+GVK ++  GA+  +L+ ++
+Sbjct: 60  VDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAQRLEDVI 102
+
+
+>ref|NP_188415.2| ATTDX (TETRATICOPEPTIDE DOMAIN-CONTAINING THIOREDOXIN);
+           thiol-disulfide exchange intermediate [Arabidopsis
+           thaliana]
+ gb|AAL54856.1| tetratricoredoxin [Arabidopsis thaliana]
+ gb|AAL54857.1| tetratricoredoxin [Arabidopsis thaliana]
+ dbj|BAD43257.1| putative HSC70-interacting protein [Arabidopsis thaliana]
+ dbj|BAE99351.1| putative HSC70-interacting protein [Arabidopsis thaliana]
+          Length = 380
+
+ Score = 75.9 bits (185), Expect = 6e-013
+ Identities = 36/110 (32%), Positives = 65/110 (59%), Gaps = 1/110 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI I S +  +A+    K+  + +++ FTATWCGPC+ ++PL+  L+  ++ +V+FLK
+Sbjct: 270 GEVISIHSTSELEAKTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHS-RVVFLK 328
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                         I+++PTF   +DG + D +VGA +  L+  +A+H++
+Sbjct: 329 VDIDKANDVAASWNISSVPTFCFIRDGKEVDKVVGADKGSLEQKIAQHSS 378
+
+
+>ref|XP_001135716.1| PREDICTED: thioredoxin domain-containing 2 isoform 2 [Pan
+           troglodytes]
+          Length = 492
+
+ Score = 75.5 bits (184), Expect = 8e-013
+ Identities = 43/108 (39%), Positives = 61/108 (56%), Gaps = 3/108 (2%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           G  V VI SK  ++A L +  E  + + VDF+ATWCGPC+ I PLF  LS  +   V+FL
+Sbjct: 386 GDKVKVILSKEDFEASLKEAGE--RLVAVDFSATWCGPCRTIRPLFHALSVKHE-DVVFL 442
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAK 108
+           +              I  +PTF  YK   K D+L GA ++KL+A++A+
+Sbjct: 443 EVDADNCEEVVRECAIMCVPTFQFYKKEEKVDELCGARKEKLEAVIAE 490
+
+
+>ref|XP_001135635.1| PREDICTED: thioredoxin domain-containing 2 isoform 1 [Pan
+           troglodytes]
+ ref|XP_512212.2| PREDICTED: thioredoxin domain-containing 2 isoform 4 [Pan
+           troglodytes]
+ ref|XP_001135962.1| PREDICTED: thioredoxin domain-containing 2 isoform 3 [Pan
+           troglodytes]
+          Length = 426
+
+ Score = 75.5 bits (184), Expect = 8e-013
+ Identities = 43/108 (39%), Positives = 61/108 (56%), Gaps = 3/108 (2%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           G  V VI SK  ++A L +  E  + + VDF+ATWCGPC+ I PLF  LS  +   V+FL
+Sbjct: 320 GDKVKVILSKEDFEASLKEAGE--RLVAVDFSATWCGPCRTIRPLFHALSVKHE-DVVFL 376
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAK 108
+           +              I  +PTF  YK   K D+L GA ++KL+A++A+
+Sbjct: 377 EVDADNCEEVVRECAIMCVPTFQFYKKEEKVDELCGARKEKLEAVIAE 424
+
+
+>ref|XP_974503.1| PREDICTED: similar to CG5495-PA [Tribolium castaneum]
+          Length = 285
+
+ Score = 75.5 bits (184), Expect = 8e-013
+ Identities = 39/108 (36%), Positives = 61/108 (56%), Gaps = 3/108 (2%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G++ VI+ ++ +  +LA      + +V DFTA+WCGPC+ IAP+F+ LS  Y  K +FLK
+Sbjct: 2   GTIKVINDESHFQTELANAST--RLVVADFTASWCGPCQRIAPIFQQLSTKYV-KAVFLK 58
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                        G++AMPTF  Y++  K D L GA    L+  + ++
+Sbjct: 59  IDVDKCQETAAMQGVSAMPTFIFYRNKTKVDTLRGADPTALENKIQQY 106
+
+
+>ref|NP_001054758.1| Os05g0169000 [Oryza sativa (japonica cultivar-group)]
+ dbj|BAF16672.1| Os05g0169000 [Oryza sativa (japonica cultivar-group)]
+ gb|EAY96693.1| hypothetical protein OsI_017926 [Oryza sativa (indica
+           cultivar-group)]
+ gb|EAZ33021.1| hypothetical protein OsJ_016504 [Oryza sativa (japonica
+           cultivar-group)]
+          Length = 132
+
+ Score = 75.5 bits (184), Expect = 8e-013
+ Identities = 38/106 (35%), Positives = 62/106 (58%), Gaps = 1/106 (0%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           GG+V VI SK  WD ++ +  ++ K +V +F+A+WCGPC++IAP++  +S  Y  +++FL
+Sbjct: 21  GGNVHVITSKEDWDRKIEEANKDGKIVVANFSASWCGPCRVIAPIYAEMSKTYP-QLMFL 79
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                          I A PTF   K+  + D LVGA++ +L+  V
+Sbjct: 80  TIDVDDLMDFSSSWDIRATPTFFFIKNEKQVDKLVGANKPELEKKV 125
+
+
+>emb|CAG25528.1| thioredoxin [Suberites ficus]
+          Length = 110
+
+ Score = 75.5 bits (184), Expect = 8e-013
+ Identities = 40/100 (40%), Positives = 57/100 (57%), Gaps = 3/100 (3%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           + +K  +D  L+  K   K +V+DFTA+WCGPCKMIAP FE +   +   V F K
+Sbjct: 5   LKNKDEFDTALSDAKAAKKWVVIDFTASWCGPCKMIAPKFEEMEKQFT-NVAFYKIDVDD 63
+
+Query: 67  XXXXXXXXGITAMPTFHVYKDGV--KADDLVGASQDKLKA 104
+                   GI+AMPTF  + DGV  K+  + GA++ KL++
+Sbjct: 64  NDEVAEAQGISAMPTFKFFYDGVEEKSKTMKGANEAKLRS 103
+
+
+>gb|AAF05765.1|AF192765_1 thioredoxin [Schizosaccharomyces pombe]
+          Length = 103
+
+ Score = 75.5 bits (184), Expect = 8e-013
+ Identities = 37/81 (45%), Positives = 50/81 (61%), Gaps = 1/81 (1%)
+
+Query: 23  EHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTF 82
+           + K +VVDF ATWCGPCK IAP FE  SN Y+    F+K             G+ AMP+F
+Sbjct: 17  QDKLVVVDFFATWCGPCKAIAPKFEQFSNTYS-DATFIKVDVDQLSEIAAEAGVHAMPSF 75
+
+Query: 83  HVYKDGVKADDLVGASQDKLK 103
+            +YK+G K +++VGA+  KL+
+Sbjct: 76  FLYKNGEKIEEIVGANPAKLE 96
+
+
+>gb|AAN63618.1|AF435817_1 thioredoxin h-like protein [Oryza sativa]
+          Length = 132
+
+ Score = 75.5 bits (184), Expect = 8e-013
+ Identities = 38/106 (35%), Positives = 62/106 (58%), Gaps = 1/106 (0%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           GG+V VI SK  WD ++ +  ++ K +V +F+A+WCGPC++IAP++  +S  Y  +++FL
+Sbjct: 21  GGNVHVITSKEDWDRKIEEANKDGKIVVANFSASWCGPCRVIAPIYAEMSKTYP-QLMFL 79
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                          I A PTF   K+  + D LVGA++ +L+  V
+Sbjct: 80  TIDVDDLMDFSSSWDIRAKPTFFFIKNEKQVDKLVGANKPELEKKV 125
+
+
+>pdb|1XWA|A Chain A, Drospohila Thioredoxin, Oxidized, P41212
+ pdb|1XWA|B Chain B, Drospohila Thioredoxin, Oxidized, P41212
+ pdb|1XWA|C Chain C, Drospohila Thioredoxin, Oxidized, P41212
+ pdb|1XWA|D Chain D, Drospohila Thioredoxin, Oxidized, P41212
+          Length = 111
+
+ Score = 75.5 bits (184), Expect = 8e-013
+ Identities = 40/103 (38%), Positives = 56/103 (54%), Gaps = 2/103 (1%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           V  +  KA  D QL K     K +V+DF ATWCGPCKMI+P    LS  +A  V+ LK
+Sbjct: 7   VYQVKDKADLDGQLTKASG--KLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVD 64
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                       I++MPTF   K+GVK ++  GA+  +L+ ++
+Sbjct: 65  VDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVI 107
+
+
+>ref|NP_523526.1| thioredoxin-2 CG31884-PA, isoform A [Drosophila melanogaster]
+ ref|NP_723475.1| thioredoxin-2 CG31884-PB, isoform B [Drosophila melanogaster]
+ pdb|1XW9|A Chain A, Drospohila Thioredoxin, Oxidized, P21
+ pdb|1XW9|B Chain B, Drospohila Thioredoxin, Oxidized, P21
+ pdb|1XW9|C Chain C, Drospohila Thioredoxin, Oxidized, P21
+ pdb|1XW9|D Chain D, Drospohila Thioredoxin, Oxidized, P21
+ pdb|1XWB|A Chain A, Drospohila Thioredoxin, Oxidized, P42212
+ pdb|1XWB|B Chain B, Drospohila Thioredoxin, Oxidized, P42212
+ pdb|1XWB|C Chain C, Drospohila Thioredoxin, Oxidized, P42212
+ pdb|1XWB|D Chain D, Drospohila Thioredoxin, Oxidized, P42212
+ pdb|1XWC|A Chain A, Drospohila Thioredoxin, Reduced, P6522
+ gb|AAF37263.1|AF220362_1 thioredoxin [Drosophila melanogaster]
+ gb|AAN10700.1| CG31884-PA, isoform A [Drosophila melanogaster]
+ gb|AAN10701.1| CG31884-PB, isoform B [Drosophila melanogaster]
+          Length = 106
+
+ Score = 75.5 bits (184), Expect = 8e-013
+ Identities = 40/103 (38%), Positives = 56/103 (54%), Gaps = 2/103 (1%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           V  +  KA  D QL K     K +V+DF ATWCGPCKMI+P    LS  +A  V+ LK
+Sbjct: 2   VYQVKDKADLDGQLTKASG--KLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVD 59
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                       I++MPTF   K+GVK ++  GA+  +L+ ++
+Sbjct: 60  VDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVI 102
+
+
+>pdb|1TRS|  Chain  , Thioredoxin Mutant With Cys 62 Replaced By Ala, Cys 69
+           Replaced By Ala, Cys 73 Replaced By Ala (C62a,C69a,C73a)
+           (Oxidized) (Nmr, Minimized Average Structure)
+ pdb|1TRU|  Chain  , Thioredoxin Mutant With Cys 62 Replaced By Ala, Cys 69
+           Replaced By Ala, Cys 73 Replaced By Ala (C62a,C69a,C73a)
+           (Oxidized) (Nmr, 40 Structures)
+ pdb|1TRV|  Chain  , Thioredoxin Mutant With Cys 62 Replaced By Ala, Cys 69
+           Replaced By Ala, Cys 73 Replaced By Ala (C62a,C69a,C73a)
+           (Reduced) (Nmr, 40 Structures)
+ pdb|1TRW|  Chain  , Thioredoxin Mutant With Cys 62 Replaced By Ala, Cys 69
+           Replaced By Ala, Cys 73 Replaced By Ala (C62a,C69a,C73a)
+           (Reduced) (Nmr, Minimized Average Structure)
+          Length = 105
+
+ Score = 75.5 bits (184), Expect = 8e-013
+ Identities = 41/100 (41%), Positives = 57/100 (57%), Gaps = 3/100 (3%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           I+SK A+   L    +  K +VVDF+ATWCGPCKMI P F +LS  Y+  VIFL+
+Sbjct: 5   IESKTAFQEALDAAGD--KLVVVDFSATWCGPCKMIKPFFHSLSEKYS-NVIFLEVDVDD 61
+
+Query: 67  XXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                    + A PTF  +K G K  +  GA+++KL+A +
+Sbjct: 62  AQDVASEAEVKATPTFQFFKKGQKVGEFSGANKEKLEATI 101
+
+
+>gb|EAY98638.1| hypothetical protein OsI_019871 [Oryza sativa (indica
+           cultivar-group)]
+          Length = 126
+
+ Score = 75.1 bits (183), Expect = 1e-012
+ Identities = 41/115 (35%), Positives = 60/115 (52%), Gaps = 6/115 (5%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHK-----PIVVDFTATWCGPCKMIAPLFETLSNDYAGK 56
+           G+VI I S   W  Q+ +     K      +V+DFTA+WCGPC++IAP+F  L+  +
+Sbjct: 12  GTVIAIHSLDEWTIQIEEANSAKKLTCSPKVVIDFTASWCGPCRIIAPVFADLAKKHT-N 70
+
+Query: 57  VIFLKXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+            +FLK              + AMPTF   K+G   D +VGA +D+L + +  H A
+Sbjct: 71  AVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAMKDELASKLELHMA 125
+
+
+>emb|CAI64400.1| thioredoxin h1 protein [Zea mays]
+          Length = 128
+
+ Score = 75.1 bits (183), Expect = 1e-012
+ Identities = 38/110 (34%), Positives = 59/110 (53%), Gaps = 1/110 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G+VI I S   W  Q+ +     K +V+DFTATWC PC+ +AP+F  ++   +  V+FLK
+Sbjct: 19  GTVIAIHSLEEWSIQIEEANSAKKLVVIDFTATWCPPCRAMAPIFADMAKK-SPNVVFLK 77
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                         + AMPTF   ++G   D +VGA++++L   +  H A
+Sbjct: 78  VDVDEMKTIAEQFSVEAMPTFLFMREGDVKDRVVGAAKEELARKLELHMA 127
+
+
+>dbj|BAE63675.1| unnamed protein product [Aspergillus oryzae]
+          Length = 107
+
+ Score = 75.1 bits (183), Expect = 1e-012
+ Identities = 36/84 (42%), Positives = 51/84 (60%), Gaps = 1/84 (1%)
+
+Query: 27  IVVDFTATWCGPCKMIAPLFETLSND-YAGKVIFLKXXXXXXXXXXXXXGITAMPTFHVY 85
+           +++DF A WCGPC+MI+P+FE L++D     + F+K             GI AMPTF V+
+Sbjct: 23  VIIDFWAPWCGPCRMISPVFERLASDPQYSSIKFVKVDVDDQPEISQECGIRAMPTFMVF 82
+
+Query: 86  KDGVKADDLVGASQDKLKALVAKH 109
+           KDG K D+ +GA  + L  LV K+
+Sbjct: 83  KDGAKLDEFMGAHPNGLHDLVQKY 106
+
+
+>ref|XP_390593.1| hypothetical protein FG10417.1 [Gibberella zeae PH-1]
+          Length = 211
+
+ Score = 75.1 bits (183), Expect = 1e-012
+ Identities = 39/106 (36%), Positives = 62/106 (58%), Gaps = 6/106 (5%)
+
+Query: 3   SVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLS--NDYAGKVIFL 60
+           S++ ID+KA +D  +    + H+ +++D +A WCGPCK +AP+FE LS  N  + KV+F
+Sbjct: 2   SIVQIDTKAQFDDLI----KSHQLVILDASAEWCGPCKAMAPIFEKLSHENPDSEKVVFA 57
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+           K             GI ++P F +++DG + D+L GA+   L  LV
+Sbjct: 58  KFDTDDVSDLAQELGIRSIPAFFIFRDGERVDNLNGANPPALTKLV 103
+
+
+>gb|ABL67652.1| putative thioredoxin H protein [Citrus cv. Shiranuhi]
+          Length = 107
+
+ Score = 74.7 bits (182), Expect = 1e-012
+ Identities = 40/102 (39%), Positives = 57/102 (55%), Gaps = 1/102 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   +  +W+ QL KG    K IVVDFTA+WC PCK+++P+   L+      VIFLK
+Sbjct: 5   GQVISCHTVESWNEQLQKGIAAKKLIVVDFTASWCPPCKLMSPILSELAKKLPA-VIFLK 63
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLK 103
+                         + AMPTF + K+G   + +VGA +D+L+
+Sbjct: 64  VDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQ 105
+
+
+>gb|AAO20259.1| thioredoxin o [Chlamydomonas reinhardtii]
+          Length = 150
+
+ Score = 74.7 bits (182), Expect = 1e-012
+ Identities = 42/109 (38%), Positives = 58/109 (53%), Gaps = 3/109 (2%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK-- 61
+           V+ + S   + A+LA        ++ DFTA WCGPC+MIAP+F +LSN Y   V F+K
+Sbjct: 42  VVEVTSDQDFSAKLADVAGSGSLMICDFTAKWCGPCRMIAPVFSSLSNKYT-DVTFVKID 100
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
+                         IT +PTF  YK G + +   GA  D L++L+ KHA
+Sbjct: 101 IDNTALGNTVNDHSITGVPTFVYYKGGRRVESFSGARADMLESLIQKHA 149
+
+
+>gb|AAM66084.1| thioredoxin [Arabidopsis thaliana]
+          Length = 134
+
+ Score = 74.7 bits (182), Expect = 1e-012
+ Identities = 37/105 (35%), Positives = 59/105 (56%), Gaps = 1/105 (0%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           V+   S A W     + KE +K +VVDF+A+WCGPC+MI P    +++ +   V F+K
+Sbjct: 28  VLKFSSSARWQLHFNEIKESNKLLVVDFSASWCGPCRMIEPAIHAMADKF-NDVDFVKLD 86
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAK 108
+                       +TAMPTF + K G + + ++GA +D+L+  V+K
+Sbjct: 87  VDELPDVAKEFNVTAMPTFVLVKRGKEIERIIGAKKDELEKKVSK 131
+
+
+>gb|AAC49356.1| thioredoxin h
+          Length = 119
+
+ Score = 74.7 bits (182), Expect = 1e-012
+ Identities = 37/108 (34%), Positives = 57/108 (52%), Gaps = 1/108 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   +   W+ ++    E  K IV+DFTA+WC PC+ IAP+F  ++  +   V+F K
+Sbjct: 5   GEVIACHTLEVWNEKVKDANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKFT-NVVFFK 63
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                         + AMPTF   K+G   D +VGA++D++   + KH
+Sbjct: 64  IDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMKH 111
+
+
+>gb|AAC49353.1| thioredoxin h
+          Length = 134
+
+ Score = 74.7 bits (182), Expect = 1e-012
+ Identities = 37/105 (35%), Positives = 59/105 (56%), Gaps = 1/105 (0%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           V+   S A W     + KE +K +VVDF+A+WCGPC+MI P    +++ +   V F+K
+Sbjct: 28  VLKFSSSARWQLHFNEIKESNKLLVVDFSASWCGPCRMIEPAIHAMADKF-NDVDFVKLD 86
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAK 108
+                       +TAMPTF + K G + + ++GA +D+L+  V+K
+Sbjct: 87  VDELPDVAKEFNVTAMPTFVLVKRGKEIERIIGAKKDELEKQVSK 131
+
+
+>gb|AAS88427.1| thioredoxin [Glycine max]
+          Length = 135
+
+ Score = 74.7 bits (182), Expect = 1e-012
+ Identities = 37/101 (36%), Positives = 54/101 (53%), Gaps = 1/101 (0%)
+
+Query: 9   SKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXX 68
+           S A W     + KE +K +V+DF+A+WCGPCK I P    +S  +   V F+K
+Sbjct: 32  SSARWQLHFNELKETNKLVVIDFSASWCGPCKFIEPAIHAMSEKFT-DVDFVKIDVDELP 90
+
+Query: 69  XXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                  + AMPTF + K G + D +VGA +D+L+  + KH
+Sbjct: 91  DVAKEFNVEAMPTFVLCKKGKEVDKVVGAKKDELEKKIEKH 131
+
+
+>ref|NP_198811.1| ATTRX2 (Arabidopsis thioredoxin h2, thioredoxin H-type 1);
+           thiol-disulfide exchange intermediate [Arabidopsis
+           thaliana]
+ sp|Q38879|TRXH2_ARATH Thioredoxin H-type 2 (TRX-H-2)
+ emb|CAA84612.1| thioredoxin [Arabidopsis thaliana]
+ dbj|BAB10219.1| thioredoxin (clone GIF2) [Arabidopsis thaliana]
+ gb|AAK82498.1| AT5g39950/MYH19_110 [Arabidopsis thaliana]
+ gb|AAM47360.1| AT5g39950/MYH19_110 [Arabidopsis thaliana]
+          Length = 133
+
+ Score = 74.7 bits (182), Expect = 1e-012
+ Identities = 37/105 (35%), Positives = 59/105 (56%), Gaps = 1/105 (0%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           V+   S A W     + KE +K +VVDF+A+WCGPC+MI P    +++ +   V F+K
+Sbjct: 27  VLKFSSSARWQLHFNEIKESNKLLVVDFSASWCGPCRMIEPAIHAMADKF-NDVDFVKLD 85
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAK 108
+                       +TAMPTF + K G + + ++GA +D+L+  V+K
+Sbjct: 86  VDELPDVAKEFNVTAMPTFVLVKRGKEIERIIGAKKDELEKKVSK 130
+
+
+>ref|NP_175128.1| ATTRX5 (thioredoxin H-type 5); thiol-disulfide exchange
+           intermediate [Arabidopsis thaliana]
+ sp|Q39241|TRXH5_ARATH Thioredoxin H-type 5 (TRX-H-5)
+ gb|AAK25937.1|AF360227_1 putative thioredoxin [Arabidopsis thaliana]
+ emb|CAA84613.1| thioredoxin [Arabidopsis thaliana]
+ gb|AAK64086.1| putative thioredoxin [Arabidopsis thaliana]
+ gb|AAM64717.1| thioredoxin, putative [Arabidopsis thaliana]
+ dbj|BAC42666.1| putative thioredoxin [Arabidopsis thaliana]
+ dbj|BAD93909.1| hypothetical protein [Arabidopsis thaliana]
+          Length = 118
+
+ Score = 74.7 bits (182), Expect = 1e-012
+ Identities = 37/108 (34%), Positives = 57/108 (52%), Gaps = 1/108 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   +   W+ ++    E  K IV+DFTA+WC PC+ IAP+F  ++  +   V+F K
+Sbjct: 5   GEVIACHTLEVWNEKVKDANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKFT-NVVFFK 63
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                         + AMPTF   K+G   D +VGA++D++   + KH
+Sbjct: 64  IDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMKH 111
+
+
+>pdb|2IWT|A Chain A, Thioredoxin H2 (Hvtrxh2) In A Mixed Disulfide Complex With
+           The Target Protein Basi
+          Length = 125
+
+ Score = 74.3 bits (181), Expect = 2e-012
+ Identities = 39/108 (36%), Positives = 58/108 (53%), Gaps = 1/108 (0%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           VI + S   W  Q+ +     K +V+DFTA+WCGP +++AP+F  L+  +    +FLK
+Sbjct: 17  VISVHSLEQWTMQIEEANTAKKLVVIDFTASWCGPSRIMAPVFADLAKKFP-NAVFLKVD 75
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                       + AMPTF   K+G   D +VGA +++L A V  HAA
+Sbjct: 76  VDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTAKVGLHAA 123
+
+
+>ref|ZP_01272767.1| Thioredoxin [Psychrobacter sp. PRwf-1]
+ gb|EAS85892.1| Thioredoxin [Psychrobacter sp. PRwf-1]
+          Length = 108
+
+ Score = 74.3 bits (181), Expect = 2e-012
+ Identities = 37/85 (43%), Positives = 50/85 (58%), Gaps = 1/85 (1%)
+
+Query: 26  PIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHVY 85
+           P++VDF A WCGPCK IAP+ E L++DY GKV  +K             GI ++PT  V+
+Sbjct: 23  PVLVDFWAAWCGPCKAIAPVLEELADDYNGKVKIVKIDVDENPETASRFGIRSIPTLMVF 82
+
+Query: 86  KDGVKADDLVGAS-QDKLKALVAKH 109
+           K G K D ++G   +  L AL+ KH
+Sbjct: 83  KGGEKVDTVMGLQPKSDLAALLDKH 107
+
+
+>ref|XP_454686.1| unnamed protein product [Kluyveromyces lactis]
+ emb|CAG99773.1| unnamed protein product [Kluyveromyces lactis NRRL Y-1140]
+          Length = 104
+
+ Score = 74.3 bits (181), Expect = 2e-012
+ Identities = 35/93 (37%), Positives = 51/93 (54%)
+
+Query: 15  AQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXX 74
+           ++  K   + K +VVDF ATWCGPCKMIAP+ E  + +Y GK  FLK
+Sbjct: 9   SEFEKALTDDKLVVVDFFATWCGPCKMIAPMLEKFAKEYEGKATFLKVDVDELPDVAKNN 68
+
+Query: 75  GITAMPTFHVYKDGVKADDLVGASQDKLKALVA 107
+            ++AMPT   +K G +   ++GA+   +K  +A
+Sbjct: 69  DVSAMPTLVFFKSGKEISRVLGANLAAIKQTIA 101
+
+
+>gb|AAD56954.1|AF186240_1 thioredoxin-like protein [Secale cereale]
+          Length = 119
+
+ Score = 74.3 bits (181), Expect = 2e-012
+ Identities = 36/99 (36%), Positives = 59/99 (59%), Gaps = 1/99 (1%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           GG+V VI +K  WD ++ +  ++ K +V +F+A+WCGPC++IAP++  +S  Y  +++FL
+Sbjct: 20  GGNVHVITTKEDWDQKIEEANKDGKIVVANFSASWCGPCRVIAPVYAEMSKTYP-QLMFL 78
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQ 99
+                          I A PTF   K+G + D LVGA++
+Sbjct: 79  TIDVDDLMDFSSTWDIRATPTFFFLKNGQQIDKLVGANK 117
+
+
+>ref|ZP_00946733.1| Thioredoxin [Ralstonia solanacearum UW551]
+ gb|EAP70779.1| Thioredoxin [Ralstonia solanacearum UW551]
+          Length = 108
+
+ Score = 74.3 bits (181), Expect = 2e-012
+ Identities = 41/102 (40%), Positives = 57/102 (55%), Gaps = 4/102 (3%)
+
+Query: 9   SKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXX 68
+           S A+++A + K     KP++VDF A WCGPCKMIAP+ + +S DYA KV   K
+Sbjct: 9   SDASFEADVLKSD---KPVLVDFWAEWCGPCKMIAPILDEVSKDYADKVQIAKLNVDENA 65
+
+Query: 69  XXXXXXGITAMPTFHVYKDGVKADDLVGA-SQDKLKALVAKH 109
+                 GI  +PT  ++K+G  A   VGA S+ +L A +  H
+Sbjct: 66  GVPAKFGIRGIPTLILFKNGAVAAQKVGALSKSQLTAFLDSH 107
+
+
+>gb|ABJ97191.1| thioredoxin-like protein [Bombyx mori]
+ gb|ABM92269.1| thioredoxin [Bombyx mori]
+          Length = 106
+
+ Score = 73.9 bits (180), Expect = 2e-012
+ Identities = 33/85 (38%), Positives = 48/85 (56%)
+
+Query: 25  KPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHV 84
+           K +V+DF ATWCGPCKMI P  + ++ + +  ++ +K              I +MPTF
+Sbjct: 21  KLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSIVVVKVDVDECEDIASEYNINSMPTFVF 80
+
+Query: 85  YKDGVKADDLVGASQDKLKALVAKH 109
+            K+G K D+  GA+ DKLK  + KH
+Sbjct: 81  VKNGKKLDEFSGANVDKLKTTILKH 105
+
+
+>emb|CAL57894.1| MGC80314 protein (ISS) [Ostreococcus tauri]
+          Length = 331
+
+ Score = 73.9 bits (180), Expect = 2e-012
+ Identities = 37/87 (42%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
+
+Query: 25  KPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHV 84
+           K + VDFTATWCGPCKMI P F +LS  +  +  F+K              +++MPTF V
+Sbjct: 241 KLVFVDFTATWCGPCKMIGPTFVSLSTKFP-RAHFIKVDVDAAQEIAGQERVSSMPTFAV 299
+
+Query: 85  YKDGVKADDLVGASQDKLKALVAKHAA 111
+           Y DG K +   GA  ++L  +V+KH A
+Sbjct: 300 YMDGNKVETFSGADANRLTQMVSKHYA 326
+
+
+>emb|CAJ20392.1| thioredoxin, putative [Toxoplasma gondii RH]
+          Length = 106
+
+ Score = 73.9 bits (180), Expect = 2e-012
+ Identities = 38/98 (38%), Positives = 58/98 (59%), Gaps = 3/98 (3%)
+
+Query: 14  DAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSN--DYAGKVIFLKXXXXXXXXXX 71
+           +AQ     EE++ ++VDF A WCGPC+ +APL E +S   +YA KV F+K
+Sbjct: 9   EAQFKSLIEENEMVLVDFYAVWCGPCRQVAPLVEAMSEKPEYA-KVKFVKIDVDELADVA 67
+
+Query: 72  XXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+               I AMPTF ++K G   D ++GA+ ++++ +V KH
+Sbjct: 68  EREEINAMPTFKLFKQGKAVDTVLGANAERVEEMVKKH 105
+
+
+>gb|AAM60989.1| tetratricoredoxin [Arabidopsis thaliana]
+          Length = 380
+
+ Score = 73.9 bits (180), Expect = 2e-012
+ Identities = 35/110 (31%), Positives = 64/110 (58%), Gaps = 1/110 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI I S +  +A+    K+  + +++ FTATWCGPC+ ++PL+  L+  ++ + +FLK
+Sbjct: 270 GEVISIHSTSELEAKTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHS-RFVFLK 328
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                         I+++PTF   +DG + D +VGA +  L+  +A+H++
+Sbjct: 329 VDIDKANDVAASWNISSVPTFCFIRDGKEVDKVVGADKGSLEQKIAQHSS 378
+
+
+>gb|AAK64512.1| Hsp70 interacting protein/thioredoxin chimera [Vitis labrusca]
+          Length = 385
+
+ Score = 73.9 bits (180), Expect = 2e-012
+ Identities = 36/109 (33%), Positives = 61/109 (55%), Gaps = 1/109 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G V+ I S +  + +L    +  +  ++ FTATWCGPC+ I+P+F +LS  Y  KV+FLK
+Sbjct: 275 GQVMAIHSSSELETKLKAASKTSRLAILYFTATWCGPCRYISPVFTSLSGKYP-KVVFLK 333
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
+                         ++++PTF   K+G + D +VG  +  L+  +A++A
+Sbjct: 334 VDIDGAQDVAVSWNVSSVPTFFFIKNGKEIDKVVGVDKSALETKIAQYA 382
+
+
+>dbj|BAC05133.1| unnamed protein product [Homo sapiens]
+          Length = 553
+
+ Score = 73.9 bits (180), Expect = 2e-012
+ Identities = 42/108 (38%), Positives = 60/108 (55%), Gaps = 3/108 (2%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           G  V VI SK  ++A L +  E  + + VDF+ATWCGPC+ I P F  LS  +   V+FL
+Sbjct: 447 GDKVKVILSKEDFEASLKEAGE--RLVAVDFSATWCGPCRTITPFFHALSVKHE-DVVFL 503
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAK 108
+           +              I  +PTF  YK   K D+L GA ++KL+A++A+
+Sbjct: 504 EVDADNCEEVVRECAIMCVPTFQFYKKEEKVDELCGALKEKLEAVIAE 551
+
+
+>ref|NP_990784.1| thioredoxin [Gallus gallus]
+ sp|P08629|THIO_CHICK Thioredoxin (Trx)
+ gb|AAA49092.1| thioredoxin
+          Length = 105
+
+ Score = 73.9 bits (180), Expect = 2e-012
+ Identities = 37/100 (37%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           + + A ++A+L    E  K +VVDF+ATWCGPCKMI P F +L + + G V+F++
+Sbjct: 5   VGNLADFEAELKAAGE--KLVVVDFSATWCGPCKMIKPFFHSLCDKF-GDVVFIEIDVDD 61
+
+Query: 67  XXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                    +  MPTF  YK+G K  +  GA+++KL+  +
+Sbjct: 62  AQDVATHCDVKCMPTFQFYKNGKKVQEFSGANKEKLEETI 101
+
+
+>pdb|3TRX|  Chain  , Thioredoxin (Reduced Form)
+ pdb|4TRX|  Chain  , Thioredoxin (Reduced Form)
+          Length = 105
+
+ Score = 73.9 bits (180), Expect = 2e-012
+ Identities = 40/100 (40%), Positives = 56/100 (56%), Gaps = 3/100 (3%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           I+SK A+   L    +  K +VVDF+ATWCGPCKMI P F +LS  Y+  VIFL+
+Sbjct: 5   IESKTAFQEALDAAGD--KLVVVDFSATWCGPCKMIKPFFHSLSEKYS-NVIFLEVDVDD 61
+
+Query: 67  XXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                    +   PTF  +K G K  +  GA+++KL+A +
+Sbjct: 62  CQDVASECEVKCTPTFQFFKKGQKVGEFSGANKEKLEATI 101
+
+
+>ref|XP_643331.1| ZZ type Zn finger-containing protein [Dictyostelium discoideum AX4]
+ gb|AAS38707.1| hypothetical protein [Dictyostelium discoideum]
+ gb|EAL69328.1| ZZ type Zn finger-containing protein [Dictyostelium discoideum AX4]
+          Length = 540
+
+ Score = 73.9 bits (180), Expect = 2e-012
+ Identities = 36/82 (43%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
+
+Query: 27  IVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHVYK 86
+           +VVDFTATWCGPCKMI+P FE LS++Y   VIFLK             G+ AMPTF  +
+Sbjct: 24  VVVDFTATWCGPCKMISPYFEQLSSEYK-DVIFLKVDVDQCKSTTQSQGVRAMPTFKFFI 82
+
+Query: 87  DGVKADDLVGASQDKLKALVAK 108
+           +  +  +  GA +++LK+ + +
+Sbjct: 83  ERKQVHEFSGADKNQLKSSIER 104
+
+
+>gb|EAX01594.1| thioredoxin domain containing 2 (spermatozoa), isoform CRA_b [Homo
+           sapiens]
+          Length = 427
+
+ Score = 73.6 bits (179), Expect = 3e-012
+ Identities = 42/108 (38%), Positives = 60/108 (55%), Gaps = 3/108 (2%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           G  V VI SK  ++A L +  E  + + VDF+ATWCGPC+ I P F  LS  +   V+FL
+Sbjct: 321 GDKVKVILSKEDFEASLKEAGE--RLVAVDFSATWCGPCRTIRPFFHALSVKHE-DVVFL 377
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAK 108
+           +              I  +PTF  YK   K D+L GA ++KL+A++A+
+Sbjct: 378 EVDADNCEEVVRECAIMCVPTFQFYKKEEKVDELCGALKEKLEAVIAE 425
+
+
+>sp|Q86VQ3|TXND2_HUMAN Thioredoxin domain-containing protein 2 (Spermatid-specific
+           thioredoxin-1) (Sptrx-1)
+          Length = 553
+
+ Score = 73.6 bits (179), Expect = 3e-012
+ Identities = 42/108 (38%), Positives = 60/108 (55%), Gaps = 3/108 (2%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           G  V VI SK  ++A L +  E  + + VDF+ATWCGPC+ I P F  LS  +   V+FL
+Sbjct: 447 GDKVKVILSKEDFEASLKEAGE--RLVAVDFSATWCGPCRTIRPFFHALSVKHE-DVVFL 503
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAK 108
+           +              I  +PTF  YK   K D+L GA ++KL+A++A+
+Sbjct: 504 EVDADNCEEVVRECAIMCVPTFQFYKKEEKVDELCGALKEKLEAVIAE 551
+
+
+>ref|XP_950855.1| PREDICTED: similar to thioredoxin domain-containing 2 isoform 2
+           [Homo sapiens]
+ gb|EAX01593.1| thioredoxin domain containing 2 (spermatozoa), isoform CRA_a [Homo
+           sapiens]
+          Length = 471
+
+ Score = 73.6 bits (179), Expect = 3e-012
+ Identities = 42/108 (38%), Positives = 60/108 (55%), Gaps = 3/108 (2%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           G  V VI SK  ++A L +  E  + + VDF+ATWCGPC+ I P F  LS  +   V+FL
+Sbjct: 365 GDKVKVILSKEDFEASLKEAGE--RLVAVDFSATWCGPCRTIRPFFHALSVKHE-DVVFL 421
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAK 108
+           +              I  +PTF  YK   K D+L GA ++KL+A++A+
+Sbjct: 422 EVDADNCEEVVRECAIMCVPTFQFYKKEEKVDELCGALKEKLEAVIAE 469
+
+
+>ref|XP_947255.1| PREDICTED: similar to Thioredoxin domain-containing protein 2
+           (Spermatid-specific thioredoxin-1) (Sptrx-1) isoform 1
+           [Homo sapiens]
+          Length = 538
+
+ Score = 73.6 bits (179), Expect = 3e-012
+ Identities = 42/108 (38%), Positives = 60/108 (55%), Gaps = 3/108 (2%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           G  V VI SK  ++A L +  E  + + VDF+ATWCGPC+ I P F  LS  +   V+FL
+Sbjct: 432 GDKVKVILSKEDFEASLKEAGE--RLVAVDFSATWCGPCRTIRPFFHALSVKHE-DVVFL 488
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAK 108
+           +              I  +PTF  YK   K D+L GA ++KL+A++A+
+Sbjct: 489 EVDADNCEEVVRECAIMCVPTFQFYKKEEKVDELCGALKEKLEAVIAE 536
+
+
+>gb|AAH50132.1| Thioredoxin domain containing 2 (spermatozoa) [Homo sapiens]
+          Length = 486
+
+ Score = 73.6 bits (179), Expect = 3e-012
+ Identities = 42/108 (38%), Positives = 60/108 (55%), Gaps = 3/108 (2%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           G  V VI SK  ++A L +  E  + + VDF+ATWCGPC+ I P F  LS  +   V+FL
+Sbjct: 380 GDKVKVILSKEDFEASLKEAGE--RLVAVDFSATWCGPCRTIRPFFHALSVKHE-DVVFL 436
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAK 108
+           +              I  +PTF  YK   K D+L GA ++KL+A++A+
+Sbjct: 437 EVDADNCEEVVRECAIMCVPTFQFYKKEEKVDELCGALKEKLEAVIAE 484
+
+
+>ref|XP_532029.2| PREDICTED: similar to Thioredoxin (ATL-derived factor) (ADF)
+           (Surface associated sulphydryl protein) (SASP) [Canis
+           familiaris]
+          Length = 219
+
+ Score = 73.6 bits (179), Expect = 3e-012
+ Identities = 35/82 (42%), Positives = 49/82 (59%), Gaps = 1/82 (1%)
+
+Query: 25  KPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHV 84
+           K +VVDF+ATWCGPCKMI P F +LS  Y+  V+FL+              +  MPTF
+Sbjct: 135 KLVVVDFSATWCGPCKMIKPFFHSLSEKYS-NVVFLEVDVDDCQDVASECEVKCMPTFQF 193
+
+Query: 85  YKDGVKADDLVGASQDKLKALV 106
+           +K G K  +  GA+++KL+A +
+Sbjct: 194 FKKGQKVGEFSGANKEKLEATI 215
+
+
+>gb|AAF86466.1|AF276919_1 thioredoxin 1 [Homo sapiens]
+ gb|AAA74596.1| thioredoxin
+          Length = 105
+
+ Score = 73.6 bits (179), Expect = 3e-012
+ Identities = 40/100 (40%), Positives = 56/100 (56%), Gaps = 3/100 (3%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           I+SK A+   L    +  K +VVDF+ATWCGPCKMI P F +LS  Y+  VIFL+
+Sbjct: 5   IESKTAFQEALDAAGD--KLVVVDFSATWCGPCKMINPFFHSLSEKYS-NVIFLEVDVDD 61
+
+Query: 67  XXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                    +   PTF  +K G K  +  GA+++KL+A +
+Sbjct: 62  CQDVASECEVKCTPTFQFFKKGQKVGEFSGANKEKLEATI 101
+
+
+>ref|NP_115619.4| thioredoxin domain-containing 2 [Homo sapiens]
+ gb|AAK94950.1|AF080095_1 sperm-specific thioredoxin [Homo sapiens]
+          Length = 486
+
+ Score = 73.6 bits (179), Expect = 3e-012
+ Identities = 42/108 (38%), Positives = 60/108 (55%), Gaps = 3/108 (2%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           G  V VI SK  ++A L +  E  + + VDF+ATWCGPC+ I P F  LS  +   V+FL
+Sbjct: 380 GDKVKVILSKEDFEASLKEAGE--RLVAVDFSATWCGPCRTIRPFFHALSVKHE-DVVFL 436
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAK 108
+           +              I  +PTF  YK   K D+L GA ++KL+A++A+
+Sbjct: 437 EVDADNCEEVVRECAIMCVPTFQFYKKEEKVDELCGALKEKLEAVIAE 484
+
+
+>ref|NP_001059090.1| Os07g0190800 [Oryza sativa (japonica cultivar-group)]
+ dbj|BAC83857.1| putative thioredoxin [Oryza sativa (japonica cultivar-group)]
+ dbj|BAF21004.1| Os07g0190800 [Oryza sativa (japonica cultivar-group)]
+ gb|EAZ03072.1| hypothetical protein OsI_024304 [Oryza sativa (indica
+           cultivar-group)]
+ gb|EAZ38983.1| hypothetical protein OsJ_022466 [Oryza sativa (japonica
+           cultivar-group)]
+          Length = 138
+
+ Score = 73.6 bits (179), Expect = 3e-012
+ Identities = 36/104 (34%), Positives = 58/104 (55%), Gaps = 1/104 (0%)
+
+Query: 3   SVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKX 62
+           +V+ + SKA WD      K   K +V+DF+A+WCGPCKM+ P+F+ ++  +   V FLK
+Sbjct: 22  AVVAVHSKAKWDELWDAHKNTTKLVVIDFSASWCGPCKMMEPVFKEMAGRFT-DVAFLKV 80
+
+Query: 63  XXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                        + AMPTF + + G +   +VGA +D+L+  +
+Sbjct: 81  DVDELAEVARTWRVEAMPTFVLARGGEEVGRIVGADKDELEKTI 124
+
+
+>ref|NP_199112.1| ATTRX3 (thioredoxin H-type 3); thiol-disulfide exchange
+           intermediate [Arabidopsis thaliana]
+ sp|Q42403|TRXH3_ARATH Thioredoxin H-type 3 (TRX-H-3)
+ emb|CAA84611.1| thioredoxin [Arabidopsis thaliana]
+ gb|AAC49351.1| thioredoxin h
+ dbj|BAB09200.1| thioredoxin (clone GIF1) [Arabidopsis thaliana]
+ gb|AAL24352.1| thioredoxin (clone GIF1) [Arabidopsis thaliana]
+ gb|AAL38274.1| thioredoxin (clone GIF1) [Arabidopsis thaliana]
+ gb|AAM13317.1| thioredoxin [Arabidopsis thaliana]
+ gb|AAM47885.1| thioredoxin clone GIF1 [Arabidopsis thaliana]
+ gb|AAM61671.1| thioredoxin [Arabidopsis thaliana]
+          Length = 118
+
+ Score = 73.6 bits (179), Expect = 3e-012
+ Identities = 39/108 (36%), Positives = 57/108 (52%), Gaps = 1/108 (0%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI   +   W  +L    E  K IV+DFTATWC PC+ IAP+F  L+  +   V+F K
+Sbjct: 5   GEVIACHTVEDWTEKLKAANESKKLIVIDFTATWCPPCRFIAPVFADLAKKHL-DVVFFK 63
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                         + AMPTF   K+G   + +VGA+++++ A + KH
+Sbjct: 64  VDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEKH 111
+
+
+>dbj|BAB02711.1| thioredoxin-like protein [Arabidopsis thaliana]
+          Length = 175
+
+ Score = 73.6 bits (179), Expect = 3e-012
+ Identities = 35/108 (32%), Positives = 64/108 (59%), Gaps = 1/108 (0%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           VI I S +  +A+    K+  + +++ FTATWCGPC+ ++PL+  L+  ++ +V+FLK
+Sbjct: 26  VISIHSTSELEAKTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHS-RVVFLKVD 84
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+                       I+++PTF   +DG + D +VGA +  L+  +A+H++
+Sbjct: 85  IDKANDVAASWNISSVPTFCFIRDGKEVDKVVGADKGSLEQKIAQHSS 132
+
+
+>sp|Q8IFW4|THIOT_DROME Thioredoxin-T (ThioredoxinT)
+ emb|CAD45644.1| thioredoxinT [Drosophila melanogaster]
+          Length = 157
+
+ Score = 73.6 bits (179), Expect = 3e-012
+ Identities = 35/88 (39%), Positives = 50/88 (56%)
+
+Query: 23  EHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTF 82
+           E K +V+DF A WCGPCK+IAP  + L+++Y+ +V+ LK              + +MPTF
+Sbjct: 19  EDKLVVIDFYADWCGPCKIIAPKLDELAHEYSDRVVVLKVNVDENEDITVEYNVNSMPTF 78
+
+Query: 83  HVYKDGVKADDLVGASQDKLKALVAKHA 110
+              K G   +  VG + DKL  L+ KHA
+Sbjct: 79  VFIKGGNVLELFVGCNSDKLAKLMEKHA 106
+
+
+>ref|XP_753517.1| thioredoxin TrxA [Aspergillus fumigatus Af293]
+ gb|EAL91479.1| thioredoxin TrxA [Aspergillus fumigatus Af293]
+ emb|CAI78450.1| thioredoxin [Aspergillus fumigatus]
+          Length = 110
+
+ Score = 73.6 bits (179), Expect = 3e-012
+ Identities = 40/101 (39%), Positives = 57/101 (56%), Gaps = 3/101 (2%)
+
+Query: 14  DAQLAKGK--EEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGK-VIFLKXXXXXXXXX 70
+           DA++ K K  E   P++VD +ATWCGPCK I+P+F+ LS     K   F +
+Sbjct: 10  DAKVFKEKVQEGSGPVIVDCSATWCGPCKAISPVFQRLSTSEEFKNAKFYEIDVDELSEV 69
+
+Query: 71  XXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+               G+ AMPTF  +KDG K +++VGA+   L+A +  H A
+Sbjct: 70  AAELGVRAMPTFMFFKDGQKVNEVVGANPPALEAAIKAHVA 110
+
+
+>sp|P08628|THIO_RABIT Thioredoxin (Trx)
+          Length = 105
+
+ Score = 73.2 bits (178), Expect = 4e-012
+ Identities = 38/100 (38%), Positives = 56/100 (56%), Gaps = 3/100 (3%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           I+SK+A+   L    +  K +VVDF+ATWCGPCKMI P F  LS  +   V+F++
+Sbjct: 5   IESKSAFQEVLDSAGD--KLVVVDFSATWCGPCKMIKPFFHALSEKF-NNVVFIEVDVDD 61
+
+Query: 67  XXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                    +  MPTF  +K G K  +  GA+++KL+A +
+Sbjct: 62  CKDIAAECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATI 101
+
+
+>ref|XP_001417928.1| predicted protein [Ostreococcus lucimarinus CCE9901]
+ gb|ABO96221.1| predicted protein [Ostreococcus lucimarinus CCE9901]
+          Length = 123
+
+ Score = 73.2 bits (178), Expect = 4e-012
+ Identities = 35/96 (36%), Positives = 56/96 (58%), Gaps = 3/96 (3%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           GS+  + + A ++A++ K      P++VDF A WCGPC+MIAPL + L+ +Y GK+  +K
+Sbjct: 17  GSLATVVTDATFEAEVLKSDV---PVLVDFWAPWCGPCRMIAPLIDQLAEEYQGKLKAVK 73
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGA 97
+                        GI ++PT  ++K G K D ++GA
+Sbjct: 74  LNTDESPSVATEYGIRSIPTVMIFKGGQKMDTVIGA 109
+
+
+>sp|Q96419|TRXH_FAGES Thioredoxin H-type (TRX-H)
+ dbj|BAA13524.1| thioredoxin [Fagopyrum esculentum]
+          Length = 116
+
+ Score = 73.2 bits (178), Expect = 4e-012
+ Identities = 37/107 (34%), Positives = 57/107 (53%), Gaps = 1/107 (0%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           VI   +   W+ +  K K+  K IV+DFTA+WCGPC++I P    L+  +   V F K
+Sbjct: 7   VIACHTVQEWNEKFQKAKDSGKLIVIDFTASWCGPCRVITPYVSELAKKFP-HVAFFKVD 65
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
+                       + AMP+F + K+G + + +VGA +D+L   +A HA
+Sbjct: 66  VDDLKDVAEEYKVEAMPSFVILKEGQEVERIVGARKDELLHKIAVHA 112
+
+
+>ref|YP_903030.1| thioredoxin [Pelobacter propionicus DSM 2379]
+ gb|ABL00973.1| thioredoxin [Pelobacter propionicus DSM 2379]
+          Length = 109
+
+ Score = 73.2 bits (178), Expect = 4e-012
+ Identities = 35/84 (41%), Positives = 52/84 (61%), Gaps = 1/84 (1%)
+
+Query: 26  PIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHVY 85
+           P++VDF ATWC PCK IAPL + ++++YAGK+   K             G+  +PT  ++
+Sbjct: 24  PVLVDFWATWCSPCKAIAPLIDAVADEYAGKIKVGKVNVDENPSTPGKYGVRGIPTLVLF 83
+
+Query: 86  KDGVKADDLVGA-SQDKLKALVAK 108
+           K GV  D +VGA  + +L+AL+AK
+Sbjct: 84  KGGVVVDQVVGAIPKSQLEALIAK 107
+
+
+>ref|XP_001422018.1| predicted protein [Ostreococcus lucimarinus CCE9901]
+ gb|ABP00312.1| predicted protein [Ostreococcus lucimarinus CCE9901]
+          Length = 101
+
+ Score = 72.8 bits (177), Expect = 5e-012
+ Identities = 37/85 (43%), Positives = 50/85 (58%), Gaps = 1/85 (1%)
+
+Query: 25  KPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHV 84
+           K + VDFTATWCGPCKMI P+F +L+  Y     F+K              +++MPTF V
+Sbjct: 12  KLVFVDFTATWCGPCKMIGPVFTSLATKYPA-AHFIKVDVDAAQDIAGYERVSSMPTFAV 70
+
+Query: 85  YKDGVKADDLVGASQDKLKALVAKH 109
+           Y +G KA+   GA  ++L  LVAK+
+Sbjct: 71  YCEGRKAETFSGADGNRLSQLVAKY 95
+
+
+>gb|ABN12051.1| putative thioredoxin-like protein [Maconellicoccus hirsutus]
+          Length = 270
+
+ Score = 72.8 bits (177), Expect = 5e-012
+ Identities = 40/106 (37%), Positives = 60/106 (56%), Gaps = 3/106 (2%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           +IVI++ A +  ++    +  K +VVD+TA+WCGPCK IAP+FE LS  Y  +  F K
+Sbjct: 3   LIVINNDAHFAQEM--NNQGVKLVVVDYTASWCGPCKRIAPVFEELSRKY-NRATFFKVD 59
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                      G++AMPTF +YK   K D + GA    L+A + ++
+Sbjct: 60  VDRCKETAASQGVSAMPTFILYKSKTKLDRVQGADAAALEAKIKQY 105
+
+
+>ref|ZP_01529583.1| thioredoxin [Roseiflexus castenholzii DSM 13941]
+ gb|EAV28690.1| thioredoxin [Roseiflexus castenholzii DSM 13941]
+          Length = 259
+
+ Score = 72.8 bits (177), Expect = 5e-012
+ Identities = 31/88 (35%), Positives = 52/88 (59%), Gaps = 1/88 (1%)
+
+Query: 24  HKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFH 83
+           H+P++VDF A WCGPC+ +AP+ E L+ ++AG+ +  K             GI ++P+ H
+Sbjct: 167 HQPVLVDFWAPWCGPCRAVAPVVERLAQEFAGRAVVAKLNVDENPRTAQRFGIRSIPSLH 226
+
+Query: 84  VYKDGVKADDLVGAS-QDKLKALVAKHA 110
+           ++KDG   + L+GA     L+  + +HA
+Sbjct: 227 IFKDGRVVERLIGAQPYPVLRQALERHA 254
+
+
+
+ Score = 33.5 bits (75), Expect = 3.4
+ Identities = 16/63 (25%), Positives = 29/63 (46%)
+
+Query: 26 PIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHVY 85
+          P+++ F    C  C+ + P  E L++ +AG+ +  +             GITA+P
+Sbjct: 23 PVLLIFDRKECPTCQRLDPTLERLASIFAGRALLARVDADDNPALAQQYGITALPGLIFV 82
+
+Query: 86 KDG 88
+          K+G
+Sbjct: 83 KNG 85
+
+
+>gb|AAK70900.1|AF394233_1 thioredoxin [Aedes aegypti]
+ gb|EAT37206.1| thioredoxin (TRX), putative [Aedes aegypti]
+          Length = 106
+
+ Score = 72.8 bits (177), Expect = 5e-012
+ Identities = 40/107 (37%), Positives = 55/107 (51%), Gaps = 2/107 (1%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           V ++   A +D++L    +  K +VVDF ATWCGPCK+IAP  E   N YA KV+ +K
+Sbjct: 2   VYIVKDAADFDSKLESAGD--KLVVVDFFATWCGPCKVIAPKLEEFQNKYAEKVLIIKVD 59
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
+                       I++MPTF   K         GA+  KL+  + KHA
+Sbjct: 60  VDECEDLAAKYEISSMPTFLFIKGKKVVYQFSGANDQKLEMYILKHA 106
+
+
+>gb|AAO72714.1| thioredoxin 1 [Melopsittacus undulatus]
+          Length = 105
+
+ Score = 72.8 bits (177), Expect = 5e-012
+ Identities = 33/80 (41%), Positives = 47/80 (58%), Gaps = 1/80 (1%)
+
+Query: 27  IVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHVYK 86
+           +VVDF+ATWCGPCKMI P F +L   Y G V+F++              +  MPTF  YK
+Sbjct: 23  VVVDFSATWCGPCKMIKPFFHSLCEKY-GDVVFIEIDVDDAQDVAAHCDVKCMPTFQFYK 81
+
+Query: 87  DGVKADDLVGASQDKLKALV 106
+           +G K  +  GA+++KL+  +
+Sbjct: 82  NGKKVQEFSGANKEKLEETI 101
+
+
+>gb|AAN63622.1|AF438359_1 thioredoxin [Triticum aestivum]
+          Length = 131
+
+ Score = 72.8 bits (177), Expect = 5e-012
+ Identities = 36/106 (33%), Positives = 62/106 (58%), Gaps = 1/106 (0%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           GG+V VI +K  WD ++ +  ++ K +V + +A+WCGPC++IAP++  +S  Y  +++FL
+Sbjct: 20  GGNVHVITTKEDWDQKIEEANKDGKIVVANLSASWCGPCRVIAPVYAEMSKTYP-QLMFL 78
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                          I A PTF   K+G + + LVGA++ +L+  V
+Sbjct: 79  TIDVDDLMDFSSTWDIRATPTFFFLKNGQQIEKLVGANKPELEKKV 124
+
+
+>gb|AAV73827.1| thioredoxin [Chlamys farreri]
+          Length = 108
+
+ Score = 72.8 bits (177), Expect = 5e-012
+ Identities = 42/108 (38%), Positives = 58/108 (53%), Gaps = 5/108 (4%)
+
+Query: 2   GSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLK 61
+           G VI + +KA +D  L    +  K +V+DF A WCGPCK IAP  E L+      VIF K
+Sbjct: 5   GKVIGLKTKADFDECL----QTDKLVVIDFFADWCGPCKQIAPAIEELAKANT-DVIFRK 59
+
+Query: 62  XXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                         I+AMPTF  YK G   D++VGA++ K++  + K+
+Sbjct: 60  VNVDENDETAQACEISAMPTFRFYKSGQTVDEVVGANKGKIEEYIVKN 107
+
+
+>ref|NP_070112.1| thioredoxin (trx-3) [Archaeoglobus fulgidus DSM 4304]
+ gb|AAB89961.1| thioredoxin (trx-3) [Archaeoglobus fulgidus DSM 4304]
+          Length = 134
+
+ Score = 72.8 bits (177), Expect = 5e-012
+ Identities = 38/89 (42%), Positives = 53/89 (59%), Gaps = 1/89 (1%)
+
+Query: 22  EEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPT 81
+           + ++ +VVDF A WC PCKMIAP+ E L+ +YAGKV+F K             GI+A+PT
+Sbjct: 45  KNNENVVVDFWAEWCMPCKMIAPVIEELAKEYAGKVVFGKLNTDENPTIAARYGISAIPT 104
+
+Query: 82  FHVYKDGVKADDLVGA-SQDKLKALVAKH 109
+              +K G   D LVGA  + +LK  V ++
+Sbjct: 105 LIFFKKGKPVDQLVGAMPKSELKRWVQRN 133
+
+
+>dbj|BAE56663.1| unnamed protein product [Aspergillus oryzae]
+          Length = 108
+
+ Score = 72.8 bits (177), Expect = 5e-012
+ Identities = 40/92 (43%), Positives = 52/92 (56%), Gaps = 7/92 (7%)
+
+Query: 22  EEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPT 81
+           + ++P+VVDF ATWCGPC+MI P  E LSN+  G V F K             GI AMPT
+Sbjct: 18  DSNEPVVVDFFATWCGPCRMITPAIERLSNENQG-VKFYKVDVDGLNTVAADLGIAAMPT 76
+
+Query: 82  FHVYKDGVKADDLV------GASQDKLKALVA 107
+           F  +KDG +  +L       G  Q+ +KAL+A
+Sbjct: 77  FVFFKDGQQIKELTIRGANPGGVQNSVKALLA 108
+
+
+>sp|Q9V429|THIO2_DROME Thioredoxin-2 (DmTrx-2)
+ gb|AAL25497.1| SD03042p [Drosophila melanogaster]
+          Length = 114
+
+ Score = 72.8 bits (177), Expect = 5e-012
+ Identities = 38/97 (39%), Positives = 54/97 (55%), Gaps = 2/97 (2%)
+
+Query: 10  KAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXX 69
+           +A  D QL K     K +V+DF ATWCGPCKMI+P    LS  +A  V+ LK
+Sbjct: 16  QADLDGQLTKASG--KLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECED 73
+
+Query: 70  XXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                 I++MPTF   K+GVK ++  GA+  +L+ ++
+Sbjct: 74  IAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVI 110
+
+
+>ref|NP_519309.1| PROBABLE THIOREDOXIN 1 (REDOX FACTOR) PROTEIN [Ralstonia
+           solanacearum GMI1000]
+ emb|CAD14890.1| probable thioredoxin 1 (redox factor) protein [Ralstonia
+           solanacearum]
+          Length = 108
+
+ Score = 72.8 bits (177), Expect = 5e-012
+ Identities = 40/102 (39%), Positives = 56/102 (54%), Gaps = 4/102 (3%)
+
+Query: 9   SKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXX 68
+           S A+++A + K     KP++VDF A WCGPCKMIAP+ + +S DY  KV   K
+Sbjct: 9   SDASFEADVLKSD---KPVLVDFWAEWCGPCKMIAPILDEVSKDYGDKVQIAKLNVDENA 65
+
+Query: 69  XXXXXXGITAMPTFHVYKDGVKADDLVGA-SQDKLKALVAKH 109
+                 GI  +PT  ++K+G  A   VGA S+ +L A +  H
+Sbjct: 66  GVPAKFGIRGIPTLILFKNGAVAAQKVGALSKSQLTAFLDSH 107
+
+
+>sp|P34723|THIO_PENCH Thioredoxin
+ emb|CAA53726.1| thioredoxin [Penicillium chrysogenum]
+          Length = 106
+
+ Score = 72.8 bits (177), Expect = 5e-012
+ Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
+
+Query: 26  PIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHVY 85
+           P+VVDF ATWCGPCK IAP  E LS  + G + F K             G++AMPTFH Y
+Sbjct: 22  PVVVDFHATWCGPCKAIAPALEKLSETHTG-IQFYKVDVDELSEVAASNGVSAMPTFHFY 80
+
+Query: 86  KDGVKADDLVGASQDKLKA 104
+           K G + +++ GA+   ++A
+Sbjct: 81  KGGERNEEVKGANPAAIQA 99
+
+
+>ref|ZP_00109755.1| COG0526: Thiol-disulfide isomerase and thioredoxins [Nostoc
+          punctiforme PCC 73102]
+          Length = 115
+
+ Score = 72.8 bits (177), Expect = 5e-012
+ Identities = 30/76 (39%), Positives = 47/76 (61%)
+
+Query: 23 EHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTF 82
+          E K +VVDFTATWCGPC++++PL E L+ +Y G+   +K             G+ ++P
+Sbjct: 24 EEKVVVVDFTATWCGPCRLVSPLMEQLAEEYKGRAKVVKVDVDRNKPIFKKFGLRSIPAV 83
+
+Query: 83 HVYKDGVKADDLVGAS 98
+           ++KDG+ A+ +VG S
+Sbjct: 84 LIFKDGILAETIVGVS 99
+
+
+>ref|XP_001374573.1| PREDICTED: similar to thioredoxin [Monodelphis domestica]
+          Length = 466
+
+ Score = 72.4 bits (176), Expect = 7e-012
+ Identities = 34/82 (41%), Positives = 49/82 (59%), Gaps = 1/82 (1%)
+
+Query: 25  KPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHV 84
+           K +VVDF+ATWCGPCKMI P F +L   Y   V+F++              +  MPTF
+Sbjct: 382 KLVVVDFSATWCGPCKMIKPFFHSLYEKYP-DVVFVEVDVDDCQDIAAECEVKCMPTFQF 440
+
+Query: 85  YKDGVKADDLVGASQDKLKALV 106
+           YK+GVK  +  GA+++KL++ +
+Sbjct: 441 YKNGVKVGEFSGANKEKLESTI 462
+
+
+>gb|ABM54166.1| thioredoxin [Brassica juncea]
+          Length = 111
+
+ Score = 72.4 bits (176), Expect = 7e-012
+ Identities = 37/106 (34%), Positives = 56/106 (52%), Gaps = 1/106 (0%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           V  + S A W       K+ ++ +V+DF+A+WCGPCK   P    ++  +   V F+K
+Sbjct: 3   VTKLSSSAQWQLHFNGMKDSNQLLVIDFSASWCGPCKSFEPAVRHMAVKFT-DVSFVKVD 61
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                       +TAMPTF + K+G + D +VGA QD+L+  V KH
+Sbjct: 62  VDELPEVAKEFDVTAMPTFVLMKNGKEVDRIVGAKQDELENKVTKH 107
+
+
+>ref|ZP_01662550.1| putative thioredoxin 1 (redox factor) protein [Ralstonia pickettii
+           12J]
+ gb|EAX43723.1| putative thioredoxin 1 (redox factor) protein [Ralstonia pickettii
+           12J]
+          Length = 108
+
+ Score = 72.4 bits (176), Expect = 7e-012
+ Identities = 40/102 (39%), Positives = 56/102 (54%), Gaps = 4/102 (3%)
+
+Query: 9   SKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXX 68
+           S A+++A + K     KP++VDF A WCGPCKMIAP+ + +S DY  KV   K
+Sbjct: 9   SDASFEADVLKSD---KPVLVDFWAEWCGPCKMIAPILDEVSKDYGEKVQIAKINVDENQ 65
+
+Query: 69  XXXXXXGITAMPTFHVYKDGVKADDLVGA-SQDKLKALVAKH 109
+                 GI  +PT  ++K+G  A   VGA S+ +L A +  H
+Sbjct: 66  GVPAKFGIRGIPTLILFKNGAVAAQKVGALSKSQLTAFLDSH 107
+
+
+>gb|AAV63537.1| fed tick salivary protein 3 [Ixodes scapularis]
+          Length = 107
+
+ Score = 72.4 bits (176), Expect = 7e-012
+ Identities = 37/104 (35%), Positives = 57/104 (54%), Gaps = 2/104 (1%)
+
+Query: 6   VIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXX 65
+           +++SK  ++ +L +  +  K +VVDF ATWCGPCKM+ P  +  S      VIFLK
+Sbjct: 5   IVESKEDFEKKLEEAGD--KLVVVDFFATWCGPCKMVEPFLKQQSEILKDVVIFLKVDVD 62
+
+Query: 66  XXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                     I  MPTF   K+  K D++ GA+++ +K ++ KH
+Sbjct: 63  ENEEITQEYEIACMPTFLFIKNKTKLDEISGANEESIKEMLDKH 106
+
+
+>ref|NP_001051587.1| Os03g0800700 [Oryza sativa (japonica cultivar-group)]
+ gb|AAO37523.1| putative thioredoxin [Oryza sativa (japonica cultivar-group)]
+ gb|ABF99385.1| Thioredoxin H-type 5, putative, expressed [Oryza sativa (japonica
+           cultivar-group)]
+ dbj|BAF13501.1| Os03g0800700 [Oryza sativa (japonica cultivar-group)]
+          Length = 134
+
+ Score = 72.4 bits (176), Expect = 7e-012
+ Identities = 38/104 (36%), Positives = 56/104 (53%), Gaps = 2/104 (1%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEE-HKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKX 62
+           V+ + S A WD Q    K   +K IV+DF+ATWCGPC+ I P F+ ++  +A   +F K
+Sbjct: 23  VVAVHSTATWDEQWGAHKSNPNKLIVIDFSATWCGPCRFIEPAFKDMAGRFA-DAVFFKI 81
+
+Query: 63  XXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                        + AMPTF + K G +   +VGA +D+L+  V
+Sbjct: 82  DVDELSEVARQWKVEAMPTFVLIKGGKEVSRVVGAKKDELERKV 125
+
+
+>ref|YP_291885.1| thioredoxin [Prochlorococcus marinus str. NATL2A]
+ ref|YP_001015347.1| Thioredoxin [Prochlorococcus marinus str. NATL1A]
+ gb|AAZ58182.1| thioredoxin [Prochlorococcus marinus str. NATL2A]
+ gb|ABM76082.1| Thioredoxin [Prochlorococcus marinus str. NATL1A]
+          Length = 107
+
+ Score = 72.4 bits (176), Expect = 7e-012
+ Identities = 33/85 (38%), Positives = 49/85 (57%), Gaps = 1/85 (1%)
+
+Query: 26  PIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHVY 85
+           P++VDF A WCGPC+M+AP+ E +S D+ GK+   K             GI ++PT  ++
+Sbjct: 22  PVLVDFWAPWCGPCRMVAPIVEEISKDFEGKIKVYKLNTDENPNVASQYGIRSIPTLMIF 81
+
+Query: 86  KDGVKADDLVGA-SQDKLKALVAKH 109
+           K G K D +VGA  +  L   ++KH
+Sbjct: 82  KGGQKVDTVVGAVPKATLSGTISKH 106
+
+
+>ref|NP_648717.1| CG13473-PA [Drosophila melanogaster]
+ gb|AAF49714.1| CG13473-PA [Drosophila melanogaster]
+ gb|AAY55405.1| IP04151p [Drosophila melanogaster]
+ gb|AAY55440.1| IP04051p [Drosophila melanogaster]
+          Length = 139
+
+ Score = 72.4 bits (176), Expect = 7e-012
+ Identities = 37/105 (35%), Positives = 60/105 (57%), Gaps = 1/105 (0%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           VI++DSK+ +D +L      +K ++V+F ATWCGPC MI P  E L++DY G+++ LK
+Sbjct: 8   VIIVDSKSYFD-KLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKID 66
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAK 108
+                       + +MPTF + K+ V     VG + +++ + V K
+Sbjct: 67  VDENEDLAVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEK 111
+
+
+>ref|NP_572212.1| Thioredoxin T CG3315-PA [Drosophila melanogaster]
+ gb|AAF46018.2| CG3315-PA [Drosophila melanogaster]
+          Length = 157
+
+ Score = 72.4 bits (176), Expect = 7e-012
+ Identities = 35/88 (39%), Positives = 48/88 (54%)
+
+Query: 23  EHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTF 82
+           E K +V+DF A WCGPCK+IAP  + L+  Y+ +V+ LK              + +MPTF
+Sbjct: 19  EDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEYNVNSMPTF 78
+
+Query: 83  HVYKDGVKADDLVGASQDKLKALVAKHA 110
+              K G   +  VG + DKL  L+ KHA
+Sbjct: 79  VFIKGGNVLELFVGCNSDKLAKLMEKHA 106
+
+
+>ref|NP_893178.1| Thioredoxin [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
+ emb|CAE19520.1| Thioredoxin [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
+          Length = 107
+
+ Score = 72.4 bits (176), Expect = 7e-012
+ Identities = 33/89 (37%), Positives = 52/89 (58%), Gaps = 1/89 (1%)
+
+Query: 22  EEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPT 81
+           + + P++VDF A WCGPC+M+AP+ E +S D+ GK+   K             GI ++PT
+Sbjct: 18  QSNLPVLVDFWAPWCGPCRMVAPVVEEISKDFEGKIKVFKLNTDENPNVASQYGIRSIPT 77
+
+Query: 82  FHVYKDGVKADDLVGA-SQDKLKALVAKH 109
+             ++K G K D +VGA  +  L + ++KH
+Sbjct: 78  LMIFKGGQKVDTVVGAVPKATLSSTLSKH 106
+
+
+>ref|YP_001011465.1| Thioredoxin [Prochlorococcus marinus str. MIT 9515]
+ gb|ABM72358.1| Thioredoxin [Prochlorococcus marinus str. MIT 9515]
+          Length = 107
+
+ Score = 72.0 bits (175), Expect = 9e-012
+ Identities = 33/85 (38%), Positives = 50/85 (58%), Gaps = 1/85 (1%)
+
+Query: 26  PIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHVY 85
+           P++VDF A WCGPC+M+AP+ E +S D+ GK+   K             GI ++PT  ++
+Sbjct: 22  PVLVDFWAPWCGPCRMVAPVVEEISKDFEGKIKVFKLNTDENPNVASQYGIRSIPTLMIF 81
+
+Query: 86  KDGVKADDLVGA-SQDKLKALVAKH 109
+           K G K D +VGA  +  L + ++KH
+Sbjct: 82  KGGQKVDTVVGAVPKATLSSTLSKH 106
+
+
+>ref|XP_001216347.1| thioredoxin [Aspergillus terreus NIH2624]
+ gb|EAU31988.1| thioredoxin [Aspergillus terreus NIH2624]
+          Length = 109
+
+ Score = 72.0 bits (175), Expect = 9e-012
+ Identities = 41/104 (39%), Positives = 57/104 (54%), Gaps = 4/104 (3%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           G SVI I SKA +  ++   +E   P+V+D  ATWCGPCK IAP  E  +  Y  +  F
+Sbjct: 3   GDSVIPITSKAEFQEKVLNAQE---PVVLDCFATWCGPCKAIAPKVEEFAKAYP-QAKFY 58
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKA 104
+           +             G+ AMPTF ++K+G K  D+VGA+   L+A
+Sbjct: 59  QIDVDELSDVAAELGVRAMPTFMLFKNGEKVSDVVGANPPALEA 102
+
+
+>gb|AAO20258.1| cytosolic thioredoxin h2 [Chlamydomonas reinhardtii]
+          Length = 109
+
+ Score = 72.0 bits (175), Expect = 9e-012
+ Identities = 40/108 (37%), Positives = 58/108 (53%), Gaps = 2/108 (1%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKE-EHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIF 59
+           GG +I + S   W + + + +    K  +VDFTA+WCGPC+ IAPL+E  S +    + F
+Sbjct: 2   GGRIIQVKSAEEWTSHMRECRAFGGKSYLVDFTASWCGPCQKIAPLYEKYSAENP-NITF 60
+
+Query: 60  LKXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVA 107
+           LK              + AMPTF  Y +G + D +VGA   KL+ L+A
+Sbjct: 61  LKVDVDELADVAGECDVKAMPTFIGYFNGEQVDTVVGADDAKLRELIA 108
+
+
+>ref|YP_320708.1| Thioredoxin [Anabaena variabilis ATCC 29413]
+ gb|ABA19813.1| Thioredoxin [Anabaena variabilis ATCC 29413]
+          Length = 108
+
+ Score = 72.0 bits (175), Expect = 9e-012
+ Identities = 33/87 (37%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
+
+Query: 23  EHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTF 82
+           E K +VVDFTATWCGPC++++PL + L+++Y G+V  +K             G+ ++P
+Sbjct: 20  EDKVVVVDFTATWCGPCRLVSPLMDQLADEYKGRVKIVKVDVDNNKPLFKKFGLRSIPAV 79
+
+Query: 83  HVYKDGVKADDLVGAS-QDKLKALVAK 108
+            ++KDG  A+ +VG S  ++  A V K
+Sbjct: 80  LIFKDGELAEKIVGVSPYEQFSAAVEK 106
+
+
+>emb|CAB66676.2| hypothetical protein [Homo sapiens]
+          Length = 161
+
+ Score = 72.0 bits (175), Expect = 9e-012
+ Identities = 41/108 (37%), Positives = 59/108 (54%), Gaps = 3/108 (2%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           G  V VI SK  ++  L +  E  + + VDF+ATWCGPC+ I P F  LS  +   V+FL
+Sbjct: 55  GDKVKVILSKEDFETSLKEAGE--RLVAVDFSATWCGPCRTIRPFFHALSVKHE-DVVFL 111
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAK 108
+           +              I  +PTF  YK   K D+L GA ++KL+A++A+
+Sbjct: 112 EVDADNCEEVVRECAIMCVPTFQFYKKEEKVDELCGALKEKLEAVIAE 159
+
+
+>ref|NP_681601.1| thioredoxin [Thermosynechococcus elongatus BP-1]
+ dbj|BAC08363.1| thioredoxin [Thermosynechococcus elongatus BP-1]
+          Length = 107
+
+ Score = 72.0 bits (175), Expect = 9e-012
+ Identities = 33/84 (39%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
+
+Query: 26  PIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHVY 85
+           P++VDF A WCGPC+M+AP+ + ++N+Y G+V  +K             GI ++PT  ++
+Sbjct: 22  PVLVDFWAPWCGPCRMVAPVVDEIANEYQGRVKVVKVNTDENSKVATDFGIRSIPTLMIF 81
+
+Query: 86  KDGVKADDLVGA-SQDKLKALVAK 108
+           K G K D LVGA  + K++A +A+
+Sbjct: 82  KGGQKVDILVGAVPKTKIEATLAQ 105
+
+
+>pdb|1MDI|A Chain A, High Resolution Solution Nmr Structure Of Mixed Disulfide
+           Intermediate Between Mutant Human Thioredoxin And A 13
+           Residue Peptide Comprising Its Target Site In Human Nfkb
+ pdb|1MDJ|A Chain A, High Resolution Solution Nmr Structure Of Mixed Disulfide
+           Intermediate Between Human Thioredoxin (C35a, C62a,
+           C69a, C73a) Mutant And A 13 Residue Peptide Comprising
+           Its Target Site In Human Nfkb (Residues 56-68 Of The P50
+           Subunit Of Nfkb)
+ pdb|1MDK|A Chain A, High Resolution Solution Nmr Structure Of Mixed Disulfide
+           Intermediate Between Human Thioredoxin (C35a, C62a,
+           C69a, C73a) Mutant And A 13 Residue Peptide Comprising
+           Its Target Site In Human Nfkb (Residues 56-68 Of The P50
+           Subunit Of Nfkb)
+ pdb|1CQH|A Chain A, High Resolution Solution Nmr Structure Of Mixed Disulfide
+           Intermediate Between Human Thioredoxin (C35a, C62a,
+           C69a, C73a) Mutant And A 13 Residue Peptide Comprising
+           Its Target Site In Human Ref-1 (Residues 59 - 71 Of The
+           P50 Subunit Of Nfkb), Nmr, Minimized Average Structure
+ pdb|1CQG|A Chain A, High Resolution Solution Nmr Structure Of Mixed Disulfide
+           Intermediate Between Human Thioredoxin (C35a, C62a,
+           C69a, C73a) Mutant And A 13 Residue Peptide Comprising
+           Its Target Site In Human Ref-1 (Residues 59 - 71 Of The
+           P50 Subunit Of Nfkb), Nmr, 31 Structures
+          Length = 105
+
+ Score = 72.0 bits (175), Expect = 9e-012
+ Identities = 40/100 (40%), Positives = 56/100 (56%), Gaps = 3/100 (3%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           I+SK A+   L    +  K +VVDF+ATWCGP KMI P F +LS  Y+  VIFL+
+Sbjct: 5   IESKTAFQEALDAAGD--KLVVVDFSATWCGPAKMIKPFFHSLSEKYS-NVIFLEVDVDD 61
+
+Query: 67  XXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                    + A PTF  +K G K  +  GA+++KL+A +
+Sbjct: 62  AQDVASEAEVKATPTFQFFKKGQKVGEFSGANKEKLEATI 101
+
+
+>ref|YP_397567.1| thioredoxin [Prochlorococcus marinus str. MIT 9312]
+ ref|YP_001009557.1| Thioredoxin [Prochlorococcus marinus str. AS9601]
+ ref|YP_001091391.1| Thioredoxin [Prochlorococcus marinus str. MIT 9301]
+ gb|ABB50131.1| thioredoxin [Prochlorococcus marinus str. MIT 9312]
+ gb|ABM70450.1| Thioredoxin [Prochlorococcus marinus str. AS9601]
+ gb|ABO17790.1| Thioredoxin [Prochlorococcus marinus str. MIT 9301]
+          Length = 107
+
+ Score = 71.6 bits (174), Expect = 1e-011
+ Identities = 33/85 (38%), Positives = 49/85 (57%), Gaps = 1/85 (1%)
+
+Query: 26  PIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHVY 85
+           P++VDF A WCGPC+M+AP+ E +S D+ GK+   K             GI ++PT  ++
+Sbjct: 22  PVLVDFWAPWCGPCRMVAPVVEEISKDFEGKIKVFKLNTDENPNVASQYGIRSIPTLMIF 81
+
+Query: 86  KDGVKADDLVGA-SQDKLKALVAKH 109
+           K G K D +VGA  +  L + + KH
+Sbjct: 82  KGGQKVDTVVGAVPKATLSSTLTKH 106
+
+
+>ref|YP_265270.1| putative thioredoxin [Psychrobacter arcticus 273-4]
+ gb|AAZ19836.1| putative thioredoxin [Psychrobacter arcticus 273-4]
+          Length = 108
+
+ Score = 71.6 bits (174), Expect = 1e-011
+ Identities = 35/85 (41%), Positives = 49/85 (57%), Gaps = 1/85 (1%)
+
+Query: 26  PIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHVY 85
+           P++VDF ATWCGPCK IAP+ E L+ +Y GKV  +K             GI  +PT  V+
+Sbjct: 23  PVLVDFWATWCGPCKAIAPILEDLATEYQGKVKIVKVDVDNNPQAASRFGIRNIPTLFVF 82
+
+Query: 86  KDGVKADDLVGAS-QDKLKALVAKH 109
+           K G K D ++G   + +L  ++ KH
+Sbjct: 83  KGGEKVDSVMGLQPKAELAKVLDKH 107
+
+
+>ref|NP_849585.1| ATHM1 (Arabidopsis thioredoxin M-type 1); thiol-disulfide exchange
+           intermediate [Arabidopsis thaliana]
+ sp|O48737|TRXM1_ARATH Thioredoxin M-type 1, chloroplast precursor (TRX-M1)
+ gb|AAF15948.1|AF095749_1 thioredoxin m1 [Arabidopsis thaliana]
+ gb|AAF86525.1|AC002560_18 F21B7.28 [Arabidopsis thaliana]
+ gb|AAO42293.1| putative thioredoxin-m [Arabidopsis thaliana]
+ gb|AAO63945.1| putative thioredoxin-m [Arabidopsis thaliana]
+          Length = 179
+
+ Score = 71.6 bits (174), Expect = 1e-011
+ Identities = 37/105 (35%), Positives = 56/105 (53%), Gaps = 4/105 (3%)
+
+Query: 5   IVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXX 64
+           I + + + WD+ + K  E   P+ VDF A WCGPCKMI P+   L+  YAG+  F K
+Sbjct: 76  IPVVNDSTWDSLVLKADE---PVFVDFWAPWCGPCKMIDPIVNELAQKYAGQFKFYKLNT 132
+
+Query: 65  XXXXXXXXXXGITAMPTFHVYKDGVKADDLVGA-SQDKLKALVAK 108
+                     G+ ++PT  ++ +G K D ++GA S+D L   + K
+Sbjct: 133 DESPATPGQYGVRSIPTIMIFVNGEKKDTIIGAVSKDTLATSINK 177
+
+
+>sp|Q5R9M3|THIO_PONPY Thioredoxin (Trx)
+ emb|CAH91537.1| hypothetical protein [Pongo pygmaeus]
+          Length = 106
+
+ Score = 71.6 bits (174), Expect = 1e-011
+ Identities = 41/101 (40%), Positives = 57/101 (56%), Gaps = 4/101 (3%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           I+SK A+   L    +  K +VVDF+ATWCGPCKMI P F +LS  Y+  VIFL+
+Sbjct: 5   IESKTAFQEALDAAGD--KLVVVDFSATWCGPCKMIKPFFHSLSEKYS-NVIFLEVDVDD 61
+
+Query: 67  XXXXXXXXGITAMPTFH-VYKDGVKADDLVGASQDKLKALV 106
+                    +  MPTF   +K G K  +  GA+++KL+A +
+Sbjct: 62  CQDVASECEVKCMPTFQFFFKKGQKVGEFSGANKEKLEATI 102
+
+
+>ref|YP_001092469.1| thioredoxin [Shewanella loihica PV-4]
+ gb|ABO22210.1| thioredoxin [Shewanella loihica PV-4]
+          Length = 108
+
+ Score = 71.6 bits (174), Expect = 1e-011
+ Identities = 34/82 (41%), Positives = 50/82 (60%), Gaps = 1/82 (1%)
+
+Query: 26  PIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHVY 85
+           P++VDF A WCGPCKMIAP+ + ++++YAGKV   K             G+  +PT  ++
+Sbjct: 23  PVLVDFWAEWCGPCKMIAPILDDVADEYAGKVTIAKLNVDQNNASPAKYGVRGIPTLLLF 82
+
+Query: 86  KDGVKADDLVGA-SQDKLKALV 106
+           K+G  AD  VGA S+ +LK  +
+Sbjct: 83  KNGELADTKVGALSKTQLKEFI 104
+
+
+>ref|YP_581553.1| thioredoxin [Psychrobacter cryohalolentis K5]
+ gb|ABE76069.1| thioredoxin [Psychrobacter cryohalolentis K5]
+          Length = 120
+
+ Score = 71.6 bits (174), Expect = 1e-011
+ Identities = 35/85 (41%), Positives = 49/85 (57%), Gaps = 1/85 (1%)
+
+Query: 26  PIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHVY 85
+           P++VDF ATWCGPCK IAP+ E L+ +Y GKV  +K             GI  +PT  V+
+Sbjct: 35  PVLVDFWATWCGPCKAIAPILEDLATEYQGKVKIVKVDVDNNPQAASRFGIRNIPTLFVF 94
+
+Query: 86  KDGVKADDLVGAS-QDKLKALVAKH 109
+           K G K D ++G   + +L  ++ KH
+Sbjct: 95  KGGEKVDSVMGLQPKAELAKVLDKH 119
+
+
+>ref|ZP_00377914.1| COG0526: Thiol-disulfide isomerase and thioredoxins
+          [Brevibacterium linens BL2]
+          Length = 107
+
+ Score = 71.6 bits (174), Expect = 1e-011
+ Identities = 31/72 (43%), Positives = 45/72 (62%)
+
+Query: 26 PIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHVY 85
+          P+VVD  ATWCGPCK IAP+ + LS++Y G+V  +K             G+T++PT   Y
+Sbjct: 21 PVVVDIWATWCGPCKQIAPILDQLSDEYEGRVKVVKIDADTNPEAVTAAGVTSIPTLGFY 80
+
+Query: 86 KDGVKADDLVGA 97
+          ++G + D L+GA
+Sbjct: 81 RNGQRRDVLIGA 92
+
+
+>ref|YP_001180505.1| thioredoxin [Caldicellulosiruptor saccharolyticus DSM 8903]
+ gb|ABP67314.1| thioredoxin [Caldicellulosiruptor saccharolyticus DSM 8903]
+          Length = 115
+
+ Score = 71.2 bits (173), Expect = 1e-011
+ Identities = 31/72 (43%), Positives = 44/72 (61%)
+
+Query: 26  PIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHVY 85
+           P+VVDF A WCGPC+M+AP+ E L+ +YAGKV F K              I ++PT  ++
+Sbjct: 30  PVVVDFWAAWCGPCRMVAPVIEELAQEYAGKVKFAKLNVDDYGDIAYAFRIMSIPTIMLF 89
+
+Query: 86  KDGVKADDLVGA 97
+           K+G   D ++GA
+Sbjct: 90  KNGQAVDKIIGA 101
+
+
+>ref|ZP_01623378.1| thioredoxin [Lyngbya sp. PCC 8106]
+ gb|EAW34650.1| thioredoxin [Lyngbya sp. PCC 8106]
+          Length = 107
+
+ Score = 71.2 bits (173), Expect = 1e-011
+ Identities = 31/76 (40%), Positives = 46/76 (60%)
+
+Query: 22 EEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPT 81
+          E   P++VDF A WCGPC+M+AP+ E ++  YAGKV  +K             GI ++PT
+Sbjct: 18 ESDVPVLVDFWAPWCGPCRMVAPVVEEIAEQYAGKVKVVKLNTDENPTVANQYGIRSIPT 77
+
+Query: 82 FHVYKDGVKADDLVGA 97
+            ++K+G + D +VGA
+Sbjct: 78 LMIFKEGQRVDMVVGA 93
+
+
+>ref|XP_001274429.1| thioredoxin TrxA [Aspergillus clavatus NRRL 1]
+ gb|EAW13003.1| thioredoxin TrxA [Aspergillus clavatus NRRL 1]
+          Length = 110
+
+ Score = 71.2 bits (173), Expect = 1e-011
+ Identities = 37/96 (38%), Positives = 54/96 (56%), Gaps = 3/96 (3%)
+
+Query: 18  AKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSN--DYAGKVIFLKXXXXXXXXXXXXXG 75
+           AK     +P++VD +ATWCGPCK I+P+F+ LSN  D+     F +             G
+Sbjct: 16  AKVFSSSEPVIVDCSATWCGPCKAISPVFQRLSNQPDFQ-NAKFYEIDVDELSDIAAELG 74
+
+Query: 76  ITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
+           + AMPTF  +KDG K +++VGA+   L+  +  H A
+Sbjct: 75  VRAMPTFMFFKDGQKVNEVVGANPPALENAIKAHVA 110
+
+
+>ref|YP_394376.1| Thioredoxin [Thiomicrospira denitrificans ATCC 33889]
+ gb|ABB45141.1| Thioredoxin [Thiomicrospira denitrificans ATCC 33889]
+          Length = 106
+
+ Score = 71.2 bits (173), Expect = 1e-011
+ Identities = 40/100 (40%), Positives = 53/100 (53%), Gaps = 10/100 (10%)
+
+Query: 13  WDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXX 72
+           ++A L+KG       +VDF A WCGPC+MIAP+ E L+NDY GK    K
+Sbjct: 12  FEATLSKGVS-----LVDFWAPWCGPCRMIAPVIEELANDYDGKAKICKVNTDEEQDIAV 66
+
+Query: 73  XXGITAMPTFHVYKDGVKADDLVGASQ-----DKLKALVA 107
+             GI ++PT   +KDG   D +VGA        K+ AL+A
+Sbjct: 67  KFGIRSIPTIMFFKDGKMVDQVVGAQSKAALAQKIDALLA 106
+
+
+>gb|AAW27028.1| SJCHGC03599 protein [Schistosoma japonicum]
+          Length = 104
+
+ Score = 71.2 bits (173), Expect = 1e-011
+ Identities = 33/89 (37%), Positives = 53/89 (59%), Gaps = 1/89 (1%)
+
+Query: 21  KEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMP 80
+           + E + +++DF A WCGPCK +AP  + +  ++   V+F+K              I AMP
+Sbjct: 16  ESETRLMILDFFADWCGPCKRVAPELDKICEEWED-VLFVKLNVDELESAAETYAIAAMP 74
+
+Query: 81  TFHVYKDGVKADDLVGASQDKLKALVAKH 109
+           TF  +K G K D++VGA+ DKL+A++ K+
+Sbjct: 75  TFIAFKGGEKVDEVVGANLDKLRAMIEKY 103
+
+
+>emb|CAE54118.1| thioredoxin-1 [Mesobuthus eupeus]
+          Length = 126
+
+ Score = 71.2 bits (173), Expect = 1e-011
+ Identities = 38/106 (35%), Positives = 55/106 (51%), Gaps = 2/106 (1%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           V ++  K  +D+Q+    E  K +V+DF ATWCGPCK IAP  E L  + +G V  LK
+Sbjct: 19  VHLVADKEDYDSQMEAAGE--KLVVIDFFATWCGPCKQIAPFIEKLEQENSGNVRCLKGD 76
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                       ++ MPT  + K+  K ++  GA Q+K+   V KH
+Sbjct: 77  VDENEELAQTFNVSWMPTLSLLKNRNKGEEFSGAKQEKVSETVDKH 122
+
+
+>sp|Q41864|TRXM_MAIZE Thioredoxin M-type, chloroplast precursor (TRX-M)
+ gb|AAA92464.1| thioredoxin M
+          Length = 167
+
+ Score = 71.2 bits (173), Expect = 1e-011
+ Identities = 38/107 (35%), Positives = 59/107 (55%), Gaps = 5/107 (4%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           V+V D K  WD  +   +    P++V+F A WCGPC+MIAP+ + L+ DYAGK+   K
+Sbjct: 61  VVVADEKN-WDGLVMACET---PVLVEFWAPWCGPCRMIAPVIDELAKDYAGKITCCKVN 116
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGA-SQDKLKALVAKH 109
+                      GI ++PT  ++K G K + ++GA  +  L  L+ K+
+Sbjct: 117 TDDSPNVASTYGIRSIPTVLIFKGGEKKESVIGAVPKSTLTTLIDKY 163
+
+
+>gb|AAC49358.1| thioredoxin m
+          Length = 172
+
+ Score = 71.2 bits (173), Expect = 1e-011
+ Identities = 34/93 (36%), Positives = 55/93 (59%), Gaps = 3/93 (3%)
+
+Query: 5   IVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXX 64
+           + + + ++WD +L  G E   P++VDF A WCGPC+MIAP+ + L+ +YAGK+   K
+Sbjct: 69  VQVVNDSSWD-ELVIGSET--PVLVDFWAPWCGPCRMIAPIIDELAKEYAGKIKCYKLNT 125
+
+Query: 65  XXXXXXXXXXGITAMPTFHVYKDGVKADDLVGA 97
+                     GI ++PT   +K+G + D ++GA
+Sbjct: 126 DESPNTATKYGIRSIPTVLFFKNGERKDSVIGA 158
+
+
+>ref|YP_429787.1| thioredoxin [Moorella thermoacetica ATCC 39073]
+ gb|ABC19244.1| thioredoxin [Moorella thermoacetica ATCC 39073]
+          Length = 108
+
+ Score = 71.2 bits (173), Expect = 1e-011
+ Identities = 32/71 (45%), Positives = 43/71 (60%)
+
+Query: 26 PIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHVY 85
+          P+VVDF A WCGPC+M+AP+ E L+ DY G V F K             GI ++PT  ++
+Sbjct: 22 PVVVDFWAVWCGPCRMMAPVLEQLAADYDGNVKFAKVNVDENQELAARYGIMSIPTLVIF 81
+
+Query: 86 KDGVKADDLVG 96
+          KDG +A  +VG
+Sbjct: 82 KDGAEAGRIVG 92
+
+
+>ref|NP_349683.1| Thioredoxin [Clostridium acetobutylicum ATCC 824]
+ gb|AAK81023.1|AE007805_4 Thioredoxin [Clostridium acetobutylicum ATCC 824]
+          Length = 105
+
+ Score = 71.2 bits (173), Expect = 1e-011
+ Identities = 34/90 (37%), Positives = 48/90 (53%), Gaps = 1/90 (1%)
+
+Query: 21  KEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMP 80
+           K   +P++VDF A WCGPCKM+ P+ + LS D  GK  F K             GI ++P
+Sbjct: 15  KTSGEPVIVDFWAPWCGPCKMLGPIIDELSEDLDGKAKFTKVNVDENPGIASKFGIASIP 74
+
+Query: 81  TFHVYKDGVKADDLVG-ASQDKLKALVAKH 109
+           T  ++KDG   + LVG   +  + A + KH
+Sbjct: 75  TVMIFKDGNPVETLVGFRPKQSITASIEKH 104
+
+
+>sp|P48384|TRXM_PEA Thioredoxin M-type, chloroplast precursor (TRX-M)
+ emb|CAA53900.1| thioredoxin m [Pisum sativum]
+          Length = 172
+
+ Score = 71.2 bits (173), Expect = 1e-011
+ Identities = 34/93 (36%), Positives = 55/93 (59%), Gaps = 3/93 (3%)
+
+Query: 5   IVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXX 64
+           + + + ++WD +L  G E   P++VDF A WCGPC+MIAP+ + L+ +YAGK+   K
+Sbjct: 69  VQVVNDSSWD-ELVIGSET--PVLVDFWAPWCGPCRMIAPIIDELAKEYAGKIKCYKLNT 125
+
+Query: 65  XXXXXXXXXXGITAMPTFHVYKDGVKADDLVGA 97
+                     GI ++PT   +K+G + D ++GA
+Sbjct: 126 DESPNTATKYGIRSIPTVLFFKNGERKDSVIGA 158
+
+
+>ref|ZP_01005152.1| Thioredoxin family protein [Prochlorococcus marinus str. MIT 9211]
+ gb|EAQ08890.1| Thioredoxin family protein [Prochlorococcus marinus str. MIT 9211]
+          Length = 107
+
+ Score = 71.2 bits (173), Expect = 1e-011
+ Identities = 32/85 (37%), Positives = 49/85 (57%), Gaps = 1/85 (1%)
+
+Query: 26  PIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHVY 85
+           P++VDF A WCGPC+M+AP+ + +S D+ GK+   K             GI ++PT  ++
+Sbjct: 22  PVLVDFWAPWCGPCRMVAPIVDEISKDFEGKIKVCKLNTDENPNVASQYGIRSIPTLMIF 81
+
+Query: 86  KDGVKADDLVGA-SQDKLKALVAKH 109
+           K G K D +VGA  +  L   ++KH
+Sbjct: 82  KGGQKVDTVVGAVPKATLSGTISKH 106
+
+
+>ref|XP_381261.1| hypothetical protein FG01085.1 [Gibberella zeae PH-1]
+          Length = 313
+
+ Score = 71.2 bits (173), Expect = 1e-011
+ Identities = 39/105 (37%), Positives = 59/105 (56%), Gaps = 6/105 (5%)
+
+Query: 6   VIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYA--GKVIFLKXX 63
+           VI SK+ +D+ L    +  + +V DF A WCGPCK IAPL+E+L+   +    V F K
+Sbjct: 7   VISSKSQFDSLL----KSSRIVVADFYADWCGPCKQIAPLYESLAITLSRPNLVTFAKIN 62
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAK 108
+                       ++ +PTF V++DG + D + GA  +KLKA++ K
+Sbjct: 63  SDEQAELSQEYSVSTLPTFLVFRDGKEIDKVQGADPNKLKAIIQK 107
+
+
+>ref|ZP_01594389.1| thioredoxin [Geobacter lovleyi SZ]
+ gb|EAV87075.1| thioredoxin [Geobacter lovleyi SZ]
+          Length = 109
+
+ Score = 70.9 bits (172), Expect = 2e-011
+ Identities = 36/84 (42%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
+
+Query: 26  PIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPTFHVY 85
+           P++VDF ATWC PCK IAPL + ++ DYAGKV   K             G+  +PT  ++
+Sbjct: 24  PVLVDFWATWCAPCKAIAPLIDAVAADYAGKVKVGKVNVDDNPATPGKYGVRGIPTLILF 83
+
+Query: 86  KDGVKADDLVGA-SQDKLKALVAK 108
+           K G   D +VGA  + +L AL+AK
+Sbjct: 84  KGGKVVDQVVGAVPKSQLDALIAK 107
+
+
+>ref|XP_001094289.1| PREDICTED: thioredoxin [Macaca mulatta]
+          Length = 104
+
+ Score = 70.9 bits (172), Expect = 2e-011
+ Identities = 40/100 (40%), Positives = 55/100 (55%), Gaps = 4/100 (4%)
+
+Query: 7   IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXX 66
+           I SKAA+   L     +   +VVDF+ATWCGPCKMI   F +LS  Y+  V+FL+
+Sbjct: 5   IKSKAAFQEALDTTGNK---LVVDFSATWCGPCKMIKSFFHSLSEKYS-NVVFLEVDVGD 60
+
+Query: 67  XXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                    +  MPTF  +K G K  +  GA+++KL+A V
+Sbjct: 61  CQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATV 100
+
+
+>ref|ZP_01289409.1| Thioredoxin [delta proteobacterium MLMS-1]
+ gb|EAT04165.1| Thioredoxin [delta proteobacterium MLMS-1]
+          Length = 109
+
+ Score = 70.9 bits (172), Expect = 2e-011
+ Identities = 39/101 (38%), Positives = 56/101 (55%), Gaps = 4/101 (3%)
+
+Query: 9   SKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXX 68
+           S A +D+Q+ +  E   P++VDF A WCGPCK I P+ E L+++YAGK    K
+Sbjct: 10  SDADFDSQVLQSAE---PVLVDFWAPWCGPCKAIGPVVEELADEYAGKAKIAKMNVDDNP 66
+
+Query: 69  XXXXXXGITAMPTFHVYKDGVKADDLVGA-SQDKLKALVAK 108
+                 GI A+PT  ++K G   D + GA  + +L AL+ K
+Sbjct: 67  ATPGKYGIRAIPTLILFKGGEVVDQVTGAVGKPQLTALIDK 107
+
+
+>dbj|BAE01341.1| unnamed protein product [Macaca fascicularis]
+          Length = 433
+
+ Score = 70.9 bits (172), Expect = 2e-011
+ Identities = 40/108 (37%), Positives = 58/108 (53%), Gaps = 3/108 (2%)
+
+Query: 1   GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFL 60
+           G  V VI SK  ++A L +  E  + + VDF+ATWCGPC+ I P F  LS  +   V+FL
+Sbjct: 327 GDKVKVILSKEDFEASLKEAGE--RLVAVDFSATWCGPCRTIKPFFHALSMKHE-DVVFL 383
+
+Query: 61  KXXXXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAK 108
+           +              I  +PTF  YK   K D+  GA ++KL+ ++A+
+Sbjct: 384 EVDADDCEEVVRDCAIMCVPTFQFYKKEEKVDEFCGALKEKLETVIAE 431
+
+
+>ref|XP_361762.1| conserved hypothetical protein [Magnaporthe grisea 70-15]
+ gb|AAX07630.1| thioredoxin-like protein [Magnaporthe grisea]
+ gb|EDJ99550.1| conserved hypothetical protein [Magnaporthe grisea 70-15]
+          Length = 107
+
+ Score = 70.9 bits (172), Expect = 2e-011
+ Identities = 34/86 (39%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
+
+Query: 22  EEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXXXXXXGITAMPT 81
+           + HK ++VDF ATWCGPC+ IAP     S+ +   + ++K              + AMPT
+Sbjct: 17  KSHKFVLVDFFATWCGPCRAIAPKIAEWSDAFP-NIHYVKVDVDEVPDVAQEYNVRAMPT 75
+
+Query: 82  FHVYKDGVKADDLVGASQDKLKALVA 107
+           F ++KDG K D++VGA+  KL+AL++
+Sbjct: 76  FLLFKDGEKVDEVVGANPPKLQALIS 101
+
+
+>sp|Q9XGS0|TRXM_BRANA Thioredoxin M-type, chloroplast precursor (TRX-M)
+ gb|AAB52409.1| thioredoxin-m [Brassica napus]
+ gb|AAD45358.1| thioredoxin-m precursor [Brassica napus]
+          Length = 177
+
+ Score = 70.9 bits (172), Expect = 2e-011
+ Identities = 32/87 (36%), Positives = 47/87 (54%), Gaps = 3/87 (3%)
+
+Query: 11  AAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXX 70
+           + W++ + K  E   P+VVDF A WCGPCKMI P+   L+  Y GK+ F K
+Sbjct: 79  STWESLVLKADE---PVVVDFWAPWCGPCKMIDPIVNELAQQYTGKIKFFKLNTDDSPAT 135
+
+Query: 71  XXXXGITAMPTFHVYKDGVKADDLVGA 97
+               G+ ++PT  ++  G K D ++GA
+Sbjct: 136 PGKYGVRSIPTIMIFVKGEKKDTIIGA 162
+
+
+>sp|Q9ZP21|TRXM_WHEAT Thioredoxin M-type, chloroplast precursor (TRX-M)
+ emb|CAA06735.1| thioredoxin M [Triticum aestivum]
+ emb|CAI35908.1| thioredoxin M precursor [Triticum turgidum subsp. durum]
+          Length = 175
+
+ Score = 70.9 bits (172), Expect = 2e-011
+ Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 4/94 (4%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           VIV D K  WD  +   +    P++V+F A WCGPC+MIAP+ + L+ DY GK+   K
+Sbjct: 70  VIVADEKN-WDNMVIACES---PVLVEFWAPWCGPCRMIAPVIDELAKDYVGKIKCCKVN 125
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGA 97
+                      GI ++PT  ++KDG K + ++GA
+Sbjct: 126 TDDCPNIASTYGIRSIPTVLMFKDGEKKESVIGA 159
+
+
+>ref|XP_001356371.1| GA16546-PA [Drosophila pseudoobscura]
+ gb|EAL33434.1| GA16546-PA [Drosophila pseudoobscura]
+          Length = 106
+
+ Score = 70.9 bits (172), Expect = 2e-011
+ Identities = 38/103 (36%), Positives = 54/103 (52%), Gaps = 2/103 (1%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           V  +  KA  DAQL +     K +V+DF ATWCGPCKMIAP    L+  YA  ++ LK
+Sbjct: 2   VYQVKDKADLDAQLQQAGS--KLVVLDFYATWCGPCKMIAPKLAELATQYADNIVILKVD 59
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALV 106
+                       I +MPTF   K+  K ++  GA+  +L+ ++
+Sbjct: 60  VDESEDIAMDYNICSMPTFVFIKNTNKVEEFAGANAQRLEDVI 102
+
+
+>ref|XP_001355410.1| GA17324-PA [Drosophila pseudoobscura]
+ gb|EAL32468.1| GA17324-PA [Drosophila pseudoobscura]
+          Length = 167
+
+ Score = 70.9 bits (172), Expect = 2e-011
+ Identities = 36/106 (33%), Positives = 55/106 (51%), Gaps = 2/106 (1%)
+
+Query: 4   VIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXX 63
+           V ++ SK  +D Q+    +  K I++DF A WCGPCK+I+P  E L+  YA + + LK
+Sbjct: 2   VYLVQSKDDFDQQVTDAGD--KLILIDFYANWCGPCKIISPKLEELAQQYADRAVVLKVN 59
+
+Query: 64  XXXXXXXXXXXGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH 109
+                       +T++PTF   K G   D  VG + +KL   + K+
+Sbjct: 60  VDENEEITIRYNVTSLPTFVFIKTGTVVDCFVGCNSEKLAKTMEKY 105
+
+
+>ref|YP_001099027.1| thioredoxin [Herminiimonas arsenicoxydans]
+ emb|CAL60900.1| thioredoxin [Herminiimonas arsenicoxydans]
+          Length = 108
+
+ Score = 70.5 bits (171), Expect = 3e-011
+ Identities = 35/87 (40%), Positives = 49/87 (56%), Gaps = 3/87 (3%)
+
+Query: 11 AAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXXXX 70
+          A++D  + K      P++VDF A WCGPCKMIAP+ E ++ +YAGK+   K
+Sbjct: 11 ASFDTDVLKSDT---PVLVDFWAEWCGPCKMIAPILEDVAKEYAGKIRIAKMDVDANQAI 67
+
+Query: 71 XXXXGITAMPTFHVYKDGVKADDLVGA 97
+              GI  +PT  ++K+GV A   VGA
+Sbjct: 68 PAKFGIRGIPTLILFKNGVPAAQKVGA 94
+
+
+>ref|ZP_01576361.1| thioredoxin [Clostridium cellulolyticum H10]
+ gb|EAV69509.1| thioredoxin [Clostridium cellulolyticum H10]
+          Length = 108
+
+ Score = 70.5 bits (171), Expect = 3e-011
+ Identities = 36/102 (35%), Positives = 58/102 (56%), Gaps = 4/102 (3%)
+
+Query: 9   SKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKXXXXXXX 68
+           SK ++++ + K     KP+VVDF A+WCGPC+M+AP+ E L++++ GK    K
+Sbjct: 9   SKDSFESNVLKSD---KPVVVDFWASWCGPCRMVAPIMEELADEFNGKASIAKVNVDEEG 65
+
+Query: 69  XXXXXXGITAMPTFHVYKDGVKADDLVGA-SQDKLKALVAKH 109
+                  I ++PT  V+K G   + +VGA S+ +   L+ KH
+Sbjct: 66  ELAAQFRIMSIPTVMVFKGGEAVEKIVGARSKAEFSELIQKH 107
+
+
+>emb|CAL52715.1| thioredoxin (ISS) [Ostreococcus tauri]
+          Length = 455
+
+ Score = 70.5 bits (171), Expect = 3e-011
+ Identities = 39/108 (36%), Positives = 61/108 (56%), Gaps = 4/108 (3%)
+
+Query: 3   SVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKX 62
+           +V+  +++ A+   L + KE  + +V+DFTA+WCGPCK IAP+F  +S +Y     FLK
+Sbjct: 336 AVVECETEEAFAEALKEAKEAKRAVVIDFTASWCGPCKRIAPVFADMSEEY--DATFLKV 393
+
+Query: 63  XXXXXXXXXXXXGITAMPTFHVY-KDGVKADDLV-GASQDKLKALVAK 108
+                        +TAMPTF  Y  +G K D+ + GA+  K+  ++ K
+Sbjct: 394 DVDKNSEVSGAHNVTAMPTFAFYDANGEKVDEQIRGANIAKITDMLDK 441
+
+
+  Database: All non-redundant GenBank CDS
+  translations+PDB+SwissProt+PIR+PRF excluding environmental samples
+  from WGS projects
+    Posted date:  May 9, 2007  5:55 PM
+  Number of letters in database: 1,693,139,330
+  Number of sequences in database:  4,904,269
+
+Lambda     K      H
+   0.319    0.134    0.000
+
+Gapped
+Lambda     K      H
+   0.267   0.0410 4.94e-324
+
+Matrix: BLOSUM62
+Gap Penalties: Existence: 11, Extension: 1
+Number of Sequences: 4904269
+Number of Hits to DB: 15242064
+Number of extensions: 437082
+Number of successful extensions: 1099
+Number of sequences better than 10: 193
+Number of HSP's better than 10 without gapping: 0
+Number of HSP's gapped: 1068
+Number of HSP's successfully gapped: 209
+Length of query: 111
+Length of database: 1693139330
+Length adjustment: 79
+Effective length of query: 32
+Effective length of database: 1305702079
+Effective search space: 41782466528
+Effective search space used: 41782466528
+T: 11
+A: 40
+X1: 16 (7.4 bits)
+X2: 38 (14.6 bits)
+X3: 64 (24.7 bits)
+S1: 41 (20.4 bits)
+S2: 72 (32.3 bits)
+
diff --git a/geneWKspace/Genetegrate/ClientCopy1.blastpgp b/geneWKspace/Genetegrate/ClientCopy1.blastpgp
new file mode 100644
index 0000000..9f8f635
--- /dev/null
+++ b/geneWKspace/Genetegrate/ClientCopy1.blastpgp
@@ -0,0 +1,1402 @@
+BLASTP 2.2.15 [Oct-15-2006]
+
+
+Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
+Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
+"Gapped BLAST and PSI-BLAST: a new generation of protein database search
+programs",  Nucleic Acids Res. 25:3389-3402.
+
+Query= 1V76:A
+         (96 letters)
+
+Database: All non-redundant GenBank CDS
+translations+PDB+SwissProt+PIR+PRF excluding environmental samples
+from WGS projects
+           4,904,269 sequences; 1,693,139,330 total letters
+
+
+
+                                                                 Score    E
+Sequences producing significant alignments:                      (bits) Value
+
+pdb|1V76|A Chain A, Crystal Structure Of Archaeal Ribonuclease P...   201   7e-051
+ref|NP_143607.1| ribonuclease P protein component 1 [Pyrococcus ...   199   3e-050
+ref|NP_126024.1| ribonuclease P protein component 1 [Pyrococcus ...   180   2e-044
+ref|NP_579545.1| ribonuclease P protein component 1 [Pyrococcus ...   166   5e-040
+ref|YP_183946.1| ribonuclease P protein component 1 [Thermococcu...   138   8e-032
+ref|NP_247439.1| hypothetical protein MJ0464 [Methanocaldococcus...    85   1e-015
+pdb|1OQK|A Chain A, Structure Of Mth11: A Homologue Of Human Rna...    82   7e-015
+ref|NP_275156.1| hypothetical protein MTH11 [Methanothermobacter...    82   7e-015
+ref|NP_614499.1| RNAse P subunit P29 [Methanopyrus kandleri AV19...    79   7e-014
+ref|ZP_01702799.1| Ribonuclease P, Rpp29 [Methanococcus vannieli...    76   6e-013
+ref|YP_447931.1| putative ribonuclease P, component 1 [Methanosp...    75   8e-013
+ref|YP_303669.1| putative ribonuclease P subunit P29 [Methanosar...    74   2e-012
+ref|NP_616025.1| hypothetical protein MA1080 [Methanosarcina ace...    71   2e-011
+ref|YP_001046487.1| Ribonuclease P, Rpp29 [Methanoculleus marisn...    71   2e-011
+ref|ZP_01799859.1| Ribonuclease P, Rpp29 [Methanococcus maripalu...    70   3e-011
+ref|YP_001041033.1| Ribonuclease P, Rpp29 [Staphylothermus marin...    70   3e-011
+ref|ZP_01798673.1| Ribonuclease P, Rpp29 [Methanococcus aeolicus...    70   4e-011
+ref|NP_988527.1| hypothetical protein MMP1407 [Methanococcus mar...    69   1e-010
+ref|YP_844126.1| Ribonuclease P, Rpp29 [Methanosaeta thermophila...    69   1e-010
+ref|NP_634156.1| Ribonuclease P protein subunit P29 [Methanosarc...    68   1e-010
+ref|YP_919897.1| Ribonuclease P, Rpp29 [Thermofilum pendens Hrk ...    67   4e-010
+sp|P22527|RNP1_HALMA Ribonuclease P protein component 1 (RNase P...    66   5e-010
+emb|CAJ37613.1| putative RNase P, component 1 [uncultured methan...    64   2e-009
+ref|YP_001096703.1| Ribonuclease P, Rpp29 [Methanococcus maripal...    64   2e-009
+ref|YP_331160.1| ribonuclease P protein component 1 [Natronomona...    64   2e-009
+ref|YP_564783.1| Ribonuclease P subunit [Methanococcoides burton...    64   3e-009
+ref|YP_001013483.1| ribonuclease P protein component 1 [Hyperthe...    62   1e-008
+ref|NP_147179.1| ribonuclease P protein component 1 [Aeropyrum p...    58   1e-007
+ref|YP_503669.1| Ribonuclease P subunit [Methanospirillum hungat...    56   5e-007
+gb|AAA86867.1| ribosomal protein                                       55   9e-007
+gb|AAU84021.1| hypothetical protein GZ35D7_6 [uncultured archaeo...    52   7e-006
+sp|P60834|RNP1_SULTO Ribonuclease P protein component 1 (RNase P...    51   2e-005
+ref|ZP_01709067.1| hypothetical protein Faci_03001135 [Ferroplas...    51   2e-005
+ref|YP_001190200.1| Ribonuclease P, Rpp29 [Metallosphaera sedula...    51   2e-005
+gb|ABK77498.1| RNase P/RNase MRP subunit p29 [Cenarchaeum symbio...    50   3e-005
+ref|NP_280464.1| hypothetical protein VNG1699C [Halobacterium sp...    47   4e-004
+ref|NP_070742.1| hypothetical protein AF1917 [Archaeoglobus fulg...    45   0.001
+ref|XP_001123127.1| PREDICTED: similar to CG8038-PA [Apis mellif...    44   0.002
+pdb|1TS9|A Chain A, Crystal Structure Of The Archaeal Homolog Of...    44   0.002
+ref|XP_969337.1| PREDICTED: similar to CG8038-PA [Tribolium cast...    44   0.003
+ref|NP_110852.1| RNAse P protein subunit p29 [Thermoplasma volca...    40   0.029
+ref|XP_665916.1| POP4 (processing of precursor , S. cerevisiae) ...    40   0.029
+ref|XP_784253.2| PREDICTED: hypothetical protein [Strongylocentr...    39   0.064
+ref|XP_001388661.1| hypothetical protein An01g02230 [Aspergillus...    39   0.084
+ref|YP_255274.1| hypothetical protein Saci_0589 [Sulfolobus acid...    39   0.084
+ref|YP_658544.1| Ribonuclease P protein component 1 (RNase P com...    38   0.19
+ref|XP_626662.1| POP4 like ribonuclease P protein subunit [Crypt...    37   0.32
+gb|EAT48803.1| ribonuclease P, 29kD-subunit, putative [Aedes aeg...    37   0.41
+gb|AAT10156.1| RNaseE subunit P29 [uncultured marine group II eu...    37   0.41
+gb|EAY93010.1| hypothetical protein OsI_014243 [Oryza sativa (in...    36   0.54
+ref|NP_001017252.1| hypothetical protein LOC550006 [Xenopus trop...    36   0.54
+ref|NP_001009642.1| processing of precursor 4, ribonuclease P/MR...    36   0.54
+ref|XP_001010353.2| hypothetical protein TTHERM_01005330 [Tetrah...    35   0.92
+ref|XP_001149011.1| PREDICTED: similar to ribonuclease P protein...    35   0.92
+ref|XP_001149162.1| PREDICTED: similar to Pop4 protein isoform 4...    35   0.92
+ref|XP_512983.2| PREDICTED: POP4 (processing of precursor , S. c...    35   0.92
+ref|XP_001149225.1| PREDICTED: similar to Pop4 protein isoform 5...    35   0.92
+gb|AAH74186.1| MGC82042 protein [Xenopus laevis]                       35   0.92
+gb|AAD00893.2| ribonuclease P protein subunit p29 [Homo sapiens]       35   0.92
+ref|NP_006618.1| POP4 (processing of precursor , S. cerevisiae) ...    35   0.92
+ref|XP_001084400.1| PREDICTED: processing of precursor 4, ribonu...    35   1.2
+sp|Q2KIB9|RPP29_BOVIN Ribonuclease P protein subunit p29 >gi|864...    35   1.2
+ref|XP_855541.1| PREDICTED: similar to Ribonuclease P protein su...    35   1.2
+ref|NP_001029942.1| POP4 (processing of precursor , S. cerevisia...    35   1.2
+sp|Q5R7B0|RP29_PONPY Ribonuclease P protein subunit p29 >gi|5573...    35   1.2
+ref|XP_701926.2| PREDICTED: hypothetical protein [Danio rerio]         35   1.6
+ref|NP_001018585.1| processing of precursor 4, ribonuclease P/MR...    35   1.6
+ref|NP_079666.1| POP4 (processing of precursor , S. cerevisiae) ...    35   1.6
+ref|XP_001231227.1| PREDICTED: similar to POP4 protein [Gallus g...    34   2.1
+ref|XP_414118.2| PREDICTED: similar to POP4 protein [Gallus gallus]    34   2.1
+ref|NP_493083.1| C15C6.4 [Caenorhabditis elegans] >gi|3874314|em...    34   2.1
+pdb|1PC0|A Chain A, Nmr Structure Of The Archaeal Homologue Of R...    34   2.7
+ref|XP_001259578.1| ribonuclease P complex subunit Pop4, putativ...    33   3.5
+gb|EAT78680.1| hypothetical protein SNOG_14055 [Phaeosphaeria no...    33   6.0
+dbj|BAE60136.1| unnamed protein product [Aspergillus oryzae]           33   6.0
+ref|XP_766695.1| hypothetical protein TP01_1174 [Theileria parva...    33   6.0
+ref|XP_001274409.1| ribonuclease P complex subunit Pop4, putativ...    32   7.8
+
+>pdb|1V76|A Chain A, Crystal Structure Of Archaeal Ribonuclease P Protein
+          Ph1771p From Pyrococcus Horikoshii Ot3
+ pdb|1V76|B Chain B, Crystal Structure Of Archaeal Ribonuclease P Protein
+          Ph1771p From Pyrococcus Horikoshii Ot3
+          Length = 96
+
+ Score =  201 bits (512), Expect = 7e-051
+ Identities = 96/96 (100%), Positives = 96/96 (100%)
+
+Query: 1  GAHRGRVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWKVPKD 60
+          GAHRGRVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWKVPKD
+Sbjct: 1  GAHRGRVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWKVPKD 60
+
+Query: 61 VSIFEFEADDGTKIKIPGERLVGRPEMRLKKRWKKW 96
+          VSIFEFEADDGTKIKIPGERLVGRPEMRLKKRWKKW
+Sbjct: 61 VSIFEFEADDGTKIKIPGERLVGRPEMRLKKRWKKW 96
+
+
+>ref|NP_143607.1| ribonuclease P protein component 1 [Pyrococcus horikoshii OT3]
+ sp|O59425|RNP1_PYRHO Ribonuclease P protein component 1 (RNase P component 1)
+ dbj|BAA30886.1| 127aa long hypothetical protein [Pyrococcus horikoshii OT3]
+          Length = 127
+
+ Score =  199 bits (507), Expect = 3e-050
+ Identities = 95/96 (98%), Positives = 95/96 (98%)
+
+Query: 1   GAHRGRVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWKVPKD 60
+           GAHRGRVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWKVPKD
+Sbjct: 32  GAHRGRVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWKVPKD 91
+
+Query: 61  VSIFEFEADDGTKIKIPGERLVGRPEMRLKKRWKKW 96
+           V IFEFEADDGTKIKIPGERLVGRPEMRLKKRWKKW
+Sbjct: 92  VCIFEFEADDGTKIKIPGERLVGRPEMRLKKRWKKW 127
+
+
+>ref|NP_126024.1| ribonuclease P protein component 1 [Pyrococcus abyssi GE5]
+ sp|Q9V1U4|RNP1_PYRAB Ribonuclease P protein component 1 (RNase P component 1)
+ emb|CAB49255.1| RNAse P protein subunit P29/POP4 [Pyrococcus abyssi GE5]
+          Length = 127
+
+ Score =  180 bits (456), Expect = 2e-044
+ Identities = 80/96 (83%), Positives = 89/96 (92%)
+
+Query: 1   GAHRGRVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWKVPKD 60
+           G+HRGRVT+RNIIWHELIGL+VR+V S HP FVGIEGYV+DETRNMLVI GD++WKVPKD
+Sbjct: 32  GSHRGRVTKRNIIWHELIGLKVRVVNSMHPGFVGIEGYVVDETRNMLVIVGDKVWKVPKD 91
+
+Query: 61  VSIFEFEADDGTKIKIPGERLVGRPEMRLKKRWKKW 96
+           V IFEFE +DG KIKIPGERLVGRPEMRLKKRW+KW
+Sbjct: 92  VCIFEFETEDGAKIKIPGERLVGRPEMRLKKRWRKW 127
+
+
+>ref|NP_579545.1| ribonuclease P protein component 1 [Pyrococcus furiosus DSM 3638]
+ sp|Q8U007|RNP1_PYRFU Ribonuclease P protein component 1 (RNase P component 1)
+ gb|AAL81940.1| hypothetical protein [Pyrococcus furiosus DSM 3638]
+          Length = 127
+
+ Score =  166 bits (419), Expect = 5e-040
+ Identities = 77/96 (80%), Positives = 88/96 (91%), Gaps = 1/96 (1%)
+
+Query: 1   GAHRGRVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGD-RIWKVPK 59
+           GAHRGRV ++NI+WHELIGL+VR+V STHP +VGIEGYVIDETRNMLVIAG+ ++WKVPK
+Sbjct: 32  GAHRGRVNKKNIVWHELIGLKVRVVNSTHPGYVGIEGYVIDETRNMLVIAGENKVWKVPK 91
+
+Query: 60  DVSIFEFEADDGTKIKIPGERLVGRPEMRLKKRWKK 95
+           DV IFEFE  DGTKIKI GE+LVGRPEMRLKKRW+K
+Sbjct: 92  DVCIFEFETWDGTKIKISGEKLVGRPEMRLKKRWRK 127
+
+
+>ref|YP_183946.1| ribonuclease P protein component 1 [Thermococcus kodakarensis KOD1]
+ sp|Q5JDH8|RNP1_PYRKO Ribonuclease P protein component 1 (RNase P component 1)
+ dbj|BAD85722.1| ribonuclease P component, Rpp29 homolog [Thermococcus kodakarensis
+           KOD1]
+          Length = 125
+
+ Score =  138 bits (348), Expect = 8e-032
+ Identities = 63/95 (66%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
+
+Query: 1   GAHRGRVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWKVPKD 60
+           GAHRGRVTR+NIIWHELIGL+ +++ ++HP  VGIEGYV+DETRN LV+ GDR+W VPKD
+Sbjct: 32  GAHRGRVTRKNIIWHELIGLKAKVIRASHPELVGIEGYVLDETRNTLVLVGDRVWVVPKD 91
+
+Query: 61  VSIFEFEADDGTKIKIPGERLVGRPEMRLKKRWKK 95
+           V   EF+  +  KI++ G+ LVGRPEMRLKKRW+K
+Sbjct: 92  VVEIEFDLGN-EKIRVNGKDLVGRPEMRLKKRWRK 125
+
+
+>ref|NP_247439.1| hypothetical protein MJ0464 [Methanocaldococcus jannaschii DSM
+          2661]
+ sp|Q57903|RNP1_METJA Ribonuclease P protein component 1 (RNase P component 1)
+ gb|AAB98453.1| conserved hypothetical protein [Methanocaldococcus jannaschii DSM
+          2661]
+          Length = 95
+
+ Score = 84.7 bits (208), Expect = 1e-015
+ Identities = 45/90 (50%), Positives = 63/90 (70%), Gaps = 3/90 (3%)
+
+Query: 7  VTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGD--RIWKVPKDVSIF 64
+          +T  NI+ HELIGL+V IV + + A +GI+G V+DETRN LVI  +  R   +PKD+++F
+Sbjct: 2  ITPHNILRHELIGLKVEIVEAKNKAMIGIKGKVVDETRNTLVIEKEDGREVVIPKDIAVF 61
+
+Query: 65 EFEADDGTKIKIPGERLVGRPEMRLKKRWK 94
+           F+   G K+K+ G  L+GRPE RLKK+ K
+Sbjct: 62 LFQL-KGCKVKVDGRLLIGRPEERLKKKIK 90
+
+
+>pdb|1OQK|A Chain A, Structure Of Mth11: A Homologue Of Human Rnase P Protein
+          Rpp29
+          Length = 97
+
+ Score = 82.4 bits (202), Expect = 7e-015
+ Identities = 45/91 (49%), Positives = 56/91 (61%), Gaps = 2/91 (2%)
+
+Query: 7  VTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGD--RIWKVPKDVSIF 64
+          +T RNI  HELIGL VRI  S H    GI G V+DETRN L I  D  R   VPK +++F
+Sbjct: 6  ITPRNIFRHELIGLSVRIARSVHRDIQGISGRVVDETRNTLRIEMDDGREITVPKGIAVF 65
+
+Query: 65 EFEADDGTKIKIPGERLVGRPEMRLKKRWKK 95
+           F    G  ++I G  LV RPE R+KK+++K
+Sbjct: 66 HFRTPQGELVEIDGRALVARPEERIKKKFRK 96
+
+
+>ref|NP_275156.1| hypothetical protein MTH11 [Methanothermobacter
+          thermautotrophicus str. Delta H]
+ sp|O26119|RNP1_METTH Ribonuclease P protein component 1 (RNase P component 1)
+ gb|AAB84512.1| conserved protein [Methanothermobacter thermautotrophicus str.
+          Delta H]
+          Length = 93
+
+ Score = 82.4 bits (202), Expect = 7e-015
+ Identities = 45/91 (49%), Positives = 56/91 (61%), Gaps = 2/91 (2%)
+
+Query: 7  VTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGD--RIWKVPKDVSIF 64
+          +T RNI  HELIGL VRI  S H    GI G V+DETRN L I  D  R   VPK +++F
+Sbjct: 2  ITPRNIFRHELIGLSVRIARSVHRDIQGISGRVVDETRNTLRIEMDDGREITVPKGIAVF 61
+
+Query: 65 EFEADDGTKIKIPGERLVGRPEMRLKKRWKK 95
+           F    G  ++I G  LV RPE R+KK+++K
+Sbjct: 62 HFRTPQGELVEIDGRALVARPEERIKKKFRK 92
+
+
+>ref|NP_614499.1| RNAse P subunit P29 [Methanopyrus kandleri AV19]
+ sp|Q8TGY6|RNP1_METKA Ribonuclease P protein component 1 (RNase P component 1)
+ gb|AAM02429.1| RNAse P subunit P29 [Methanopyrus kandleri AV19]
+          Length = 107
+
+ Score = 79.0 bits (193), Expect = 7e-014
+ Identities = 40/91 (43%), Positives = 60/91 (65%), Gaps = 5/91 (5%)
+
+Query: 7  VTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVI---AGDRIWKVPKDVSI 63
+          +T RNI+ HELIGL  R+V S  P + G+EG ++DET+N LV+   +G+++  + KD  +
+Sbjct: 3  ITPRNIVRHELIGLECRVVKSLGPPYEGLEGRIVDETKNTLVLKTESGEKV--IVKDQVL 60
+
+Query: 64 FEFEADDGTKIKIPGERLVGRPEMRLKKRWK 94
+           E +   G ++++ G  LVGRPE RL KR K
+Sbjct: 61 LELKLPSGERVRVDGALLVGRPEERLSKRIK 91
+
+
+>ref|ZP_01702799.1| Ribonuclease P, Rpp29 [Methanococcus vannielii SB]
+ sp|P14022|RNP1_METVA Ribonuclease P protein component 1 (RNase P component 1)
+ emb|CAA34688.1| unnamed protein product [Methanococcus vannielii]
+ gb|EAY51284.1| Ribonuclease P, Rpp29 [Methanococcus vannielii SB]
+          Length = 99
+
+ Score = 75.9 bits (185), Expect = 6e-013
+ Identities = 45/92 (48%), Positives = 59/92 (64%), Gaps = 7/92 (7%)
+
+Query: 10 RNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIA---GDRIWKVPKDVSIFEF 66
+          +NI+ HEL+GL + IV ST    +  +G VI+ETRNMLVI    G  I  VPK++SIF F
+Sbjct: 5  QNILRHELVGLNLEIVNSTDKRLISTKGRVINETRNMLVIEKNNGKEI-TVPKEISIFRF 63
+
+Query: 67 E---ADDGTKIKIPGERLVGRPEMRLKKRWKK 95
+          E    D   K+ I G  L+GRPE RLK++ K+
+Sbjct: 64 EFSDLDTPKKVDIDGRLLIGRPEDRLKRKIKQ 95
+
+
+>ref|YP_447931.1| putative ribonuclease P, component 1 [Methanosphaera stadtmanae
+          DSM 3091]
+ gb|ABC57288.1| putative ribonuclease P, component 1 [Methanosphaera stadtmanae
+          DSM 3091]
+          Length = 93
+
+ Score = 75.5 bits (184), Expect = 8e-013
+ Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 1/90 (1%)
+
+Query: 7  VTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNML-VIAGDRIWKVPKDVSIFE 65
+          +T +N+  HE IGL V ++ S H  F+GI+G +IDETRN + V  G     +PK   +F
+Sbjct: 2  ITPQNVFRHEFIGLNVEVINSKHEKFIGIKGIIIDETRNTIRVDTGKNEKLIPKSDVVFL 61
+
+Query: 66 FEADDGTKIKIPGERLVGRPEMRLKKRWKK 95
+          F    G K+ I G+ +  RPE R+KK++ K
+Sbjct: 62 FTLPQGEKVSIDGKVITARPEDRIKKKFTK 91
+
+
+>ref|YP_303669.1| putative ribonuclease P subunit P29 [Methanosarcina barkeri str.
+           fusaro]
+ gb|AAZ69089.1| putative ribonuclease P subunit P29 [Methanosarcina barkeri str.
+           Fusaro]
+          Length = 110
+
+ Score = 73.9 bits (180), Expect = 2e-012
+ Identities = 42/98 (42%), Positives = 61/98 (62%), Gaps = 13/98 (13%)
+
+Query: 12  IIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVI--AGDRIWKVPKDVSIFEFEAD 69
+           +I+HELIGL ++++ ST+PA +GI G VIDET+N+L+I  +G R  K+PK  S F F
+Sbjct: 12  LIYHELIGLEIQVIRSTNPALIGIRGRVIDETKNLLIIENSGPRELKIPKADSEFLFRIP 71
+
+Query: 70  ---------DGTKIKIPGERLVGRPEMRLK--KRWKKW 96
+                      T +KI G  L+ +PE R+K  K+ +KW
+Sbjct: 72  TELSEKGRRSDTFVKIQGNLLLSQPENRIKNIKKLRKW 109
+
+
+>ref|NP_616025.1| hypothetical protein MA1080 [Methanosarcina acetivorans C2A]
+ sp|Q8TRT9|RNP1_METAC Ribonuclease P protein component 1 (RNase P component 1)
+ gb|AAM04505.1| conserved hypothetical protein [Methanosarcina acetivorans C2A]
+          Length = 110
+
+ Score = 71.2 bits (173), Expect = 2e-011
+ Identities = 41/99 (41%), Positives = 60/99 (60%), Gaps = 13/99 (13%)
+
+Query: 11  NIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVI--AGDRIWKVPKDVSIFEFEA 68
+           N+I+HELIGL ++++ ST+P+  GI G VI+ET+NMLV+  +  R  K+PK  S F F
+Sbjct: 11  NLIFHELIGLEIKVINSTNPSLTGIRGRVINETKNMLVVENSQSRELKIPKADSEFLFRI 70
+
+Query: 69  D---------DGTKIKIPGERLVGRPEMRLK--KRWKKW 96
+                       T +KI G  L+ +PE R+K  K+ +KW
+Sbjct: 71  PAELSEKGRRSDTFVKIQGNLLLSQPENRIKNIKKLRKW 109
+
+
+>ref|YP_001046487.1| Ribonuclease P, Rpp29 [Methanoculleus marisnigri JR1]
+ gb|ABN56505.1| Ribonuclease P, Rpp29 [Methanoculleus marisnigri JR1]
+          Length = 90
+
+ Score = 70.9 bits (172), Expect = 2e-011
+ Identities = 37/87 (42%), Positives = 53/87 (60%), Gaps = 1/87 (1%)
+
+Query: 7  VTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWK-VPKDVSIFE 65
+          ++ +N++ HELIGL V +V +++P   G+ G V DETRN LVI   R  K +PK  S+F
+Sbjct: 2  ISPQNVLRHELIGLDVLVVRASNPGHAGVSGRVTDETRNTLVILTGRGEKQIPKRFSVFR 61
+
+Query: 66 FEADDGTKIKIPGERLVGRPEMRLKKR 92
+          F   DGT + + G  L  +PE R+  R
+Sbjct: 62 FRLPDGTTVDVDGSSLETQPERRIGMR 88
+
+
+>ref|ZP_01799859.1| Ribonuclease P, Rpp29 [Methanococcus maripaludis C7]
+ gb|EDK17654.1| Ribonuclease P, Rpp29 [Methanococcus maripaludis C7]
+          Length = 98
+
+ Score = 70.1 bits (170), Expect = 3e-011
+ Identities = 41/90 (45%), Positives = 59/90 (65%), Gaps = 4/90 (4%)
+
+Query: 10 RNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGD--RIWKVPKDVSIF--E 65
+          +NI+ HELIGL + +V ST  + +  +G VI+ETRN LV+  +  +   V K++S F  +
+Sbjct: 5  QNILRHELIGLNLEVVKSTDFSLISTKGRVINETRNTLVLEKENGKEITVVKEISTFRIQ 64
+
+Query: 66 FEADDGTKIKIPGERLVGRPEMRLKKRWKK 95
+          FE DD  K+ I G  LVGRPE RLK++ K+
+Sbjct: 65 FEFDDVVKVDIDGRLLVGRPEDRLKRKIKQ 94
+
+
+>ref|YP_001041033.1| Ribonuclease P, Rpp29 [Staphylothermus marinus F1]
+ gb|ABN70125.1| Ribonuclease P, Rpp29 [Staphylothermus marinus F1]
+          Length = 92
+
+ Score = 70.1 bits (170), Expect = 3e-011
+ Identities = 40/88 (45%), Positives = 58/88 (65%), Gaps = 4/88 (4%)
+
+Query: 6  RVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVI---AGDRIWKVPKDVS 62
+          R TRRNI +HELIGLR++I+     + VG+ G VIDET+  L+I   +G R+ +V K
+Sbjct: 2  RHTRRNIFYHELIGLRIKIIEYPDKSLVGLTGLVIDETQKTLLIETNSGRRV-RVLKANG 60
+
+Query: 63 IFEFEADDGTKIKIPGERLVGRPEMRLK 90
+          +F+F   +  K+ I G +++GRPE RLK
+Sbjct: 61 VFQFMLPNKEKVIIRGVQILGRPEDRLK 88
+
+
+>ref|ZP_01798673.1| Ribonuclease P, Rpp29 [Methanococcus aeolicus Nankai-3]
+ gb|EDK15668.1| Ribonuclease P, Rpp29 [Methanococcus aeolicus Nankai-3]
+          Length = 96
+
+ Score = 69.7 bits (169), Expect = 4e-011
+ Identities = 38/91 (41%), Positives = 61/91 (67%), Gaps = 4/91 (4%)
+
+Query: 7  VTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIA---GDRIWKVPKDVSI 63
+          +T  NI+ HELIGL V I  ST+ + VG++G ++ ETRN + I      +   +PKD+++
+Sbjct: 2  ITPYNILRHELIGLDVEITQSTNKSLVGLKGKIVYETRNTINIERFDNSKEVMIPKDIAV 61
+
+Query: 64 FEFEADDGTKIKIPGERLVGRPEMRLKKRWK 94
+          F+F+ ++   I++ GE L+GRPE RLK++ K
+Sbjct: 62 FKFKLNE-EYIEVIGELLMGRPEDRLKRKIK 91
+
+
+>ref|NP_988527.1| hypothetical protein MMP1407 [Methanococcus maripaludis S2]
+ sp|P60832|RNP1_METMP Ribonuclease P protein component 1 (RNase P component 1)
+ emb|CAF30963.1| Protein of unknown function UPF0086 [Methanococcus maripaludis
+          S2]
+          Length = 96
+
+ Score = 68.6 bits (166), Expect = 1e-010
+ Identities = 42/91 (46%), Positives = 59/91 (64%), Gaps = 6/91 (6%)
+
+Query: 10 RNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIA---GDRIWKVPKDVSIF-- 64
+          +NI+ HELIGL + +V ST    +  +G VI+ETRN LV+    G  I  V K++S F
+Sbjct: 3  QNILRHELIGLNLEVVKSTDSGLISTKGRVINETRNTLVLEKENGKEITLV-KEISTFRI 61
+
+Query: 65 EFEADDGTKIKIPGERLVGRPEMRLKKRWKK 95
+          +FE+++  KI I G  LVGRPE RLK++ K+
+Sbjct: 62 QFESENVVKIDIDGRLLVGRPEDRLKRKIKQ 92
+
+
+>ref|YP_844126.1| Ribonuclease P, Rpp29 [Methanosaeta thermophila PT]
+ gb|ABK15486.1| Ribonuclease P, Rpp29 [Methanosaeta thermophila PT]
+          Length = 96
+
+ Score = 68.6 bits (166), Expect = 1e-010
+ Identities = 36/83 (43%), Positives = 50/83 (60%), Gaps = 1/83 (1%)
+
+Query: 11 NIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDR-IWKVPKDVSIFEFEAD 69
+          NI  HELIGL V ++ + +    G+ G V+DETRN  VI   R + +VPK  + F F
+Sbjct: 6  NIARHELIGLTVEVIDTPNRTMAGMRGLVVDETRNTFVIETQRGLRRVPKAHTSFIFTLP 65
+
+Query: 70 DGTKIKIPGERLVGRPEMRLKKR 92
+          DG K++I G  L+ +PE R+ KR
+Sbjct: 66 DGQKVRIAGSVLISQPENRINKR 88
+
+
+>ref|NP_634156.1| Ribonuclease P protein subunit P29 [Methanosarcina mazei Go1]
+ sp|Q8PV42|RNP1_METMA Ribonuclease P protein component 1 (RNase P component 1)
+ gb|AAM31828.1| Ribonuclease P protein subunit P29 [Methanosarcina mazei Go1]
+          Length = 110
+
+ Score = 68.2 bits (165), Expect = 1e-010
+ Identities = 40/98 (40%), Positives = 62/98 (63%), Gaps = 13/98 (13%)
+
+Query: 12  IIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVI--AGDRIWKVPKDVSIFEFE-- 67
+           +I+HELIGL +++  ST+P+ +GI G VI+ET+NMLV+  +  R  K+PK  S F F
+Sbjct: 12  LIFHELIGLEIKVSNSTNPSLIGIRGRVINETKNMLVVENSESRELKIPKADSEFVFRIP 71
+
+Query: 68  ---ADDGTK----IKIPGERLVGRPEMRLK--KRWKKW 96
+              ++ G +    +KI G  L+ +PE R+K  K+ +KW
+Sbjct: 72  AELSEKGRRSDIFVKIQGNLLLSQPENRIKNIKKLRKW 109
+
+
+>ref|YP_919897.1| Ribonuclease P, Rpp29 [Thermofilum pendens Hrk 5]
+ gb|ABL77894.1| Ribonuclease P, Rpp29 [Thermofilum pendens Hrk 5]
+          Length = 94
+
+ Score = 66.6 bits (161), Expect = 4e-010
+ Identities = 37/93 (39%), Positives = 55/93 (59%), Gaps = 2/93 (2%)
+
+Query: 6  RVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIA--GDRIWKVPKDVSI 63
+          ++T +NI+ HELIGL   +V S +P+ VGI G ++DET   +VI   G    ++ K   +
+Sbjct: 2  KITPKNILRHELIGLEACVVKSKNPSQVGICGLILDETYKTIVIGVPGGPKKRIFKAQVV 61
+
+Query: 64 FEFEADDGTKIKIPGERLVGRPEMRLKKRWKKW 96
+             +  DG ++ + G  LVGRPE RLK+R   W
+Sbjct: 62 LRIKLPDGKELLVDGAFLVGRPEERLKRRVMLW 94
+
+
+>sp|P22527|RNP1_HALMA Ribonuclease P protein component 1 (RNase P component 1)
+ emb|CAA39016.1| unnamed protein product [Haloarcula marismortui]
+          Length = 94
+
+ Score = 66.2 bits (160), Expect = 5e-010
+ Identities = 33/75 (44%), Positives = 47/75 (62%), Gaps = 2/75 (2%)
+
+Query: 15 HELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAG-DRIWKVPKDVSIFEFEADDGTK 73
+          HEL+GL   +V +++P  +GI G V+ ET  ML + G DR+W VPKD + F F+    T
+Sbjct: 11 HELVGLDCEVVAASNPDVIGISGTVVMETTQMLTLEGADRVWHVPKDSATFAFDLSTET- 69
+
+Query: 74 IKIPGERLVGRPEMR 88
+          + + G+RLV RP  R
+Sbjct: 70 VLVDGDRLVARPARR 84
+
+
+>emb|CAJ37613.1| putative RNase P, component 1 [uncultured methanogenic archaeon
+          RC-I]
+          Length = 90
+
+ Score = 64.3 bits (155), Expect = 2e-009
+ Identities = 37/86 (43%), Positives = 53/86 (61%), Gaps = 5/86 (5%)
+
+Query: 11 NIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVI-AGDRIWKVPKDVSIFEFEAD 69
+          NII+HELIGL+V +     P +V + G V+DETRNM++I  G R  KVPK    F F
+Sbjct: 7  NIIYHELIGLKVEV---ETPPYV-LTGKVVDETRNMIIINTGKRDAKVPKSCCTFVFTLP 62
+
+Query: 70 DGTKIKIPGERLVGRPEMRLKKRWKK 95
+          D  ++++ G  L  +PE R+ K+ +K
+Sbjct: 63 DSRRVRVLGTLLQSQPENRIPKKRRK 88
+
+
+>ref|YP_001096703.1| Ribonuclease P, Rpp29 [Methanococcus maripaludis C5]
+ gb|ABO34488.1| Ribonuclease P, Rpp29 [Methanococcus maripaludis C5]
+          Length = 99
+
+ Score = 63.9 bits (154), Expect = 2e-009
+ Identities = 38/91 (41%), Positives = 56/91 (61%), Gaps = 5/91 (5%)
+
+Query: 10 RNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGD--RIWKVPKDVSIFEFE 67
+          +NI+ HELIGL + +V ST    +  +G VI+ETRN LV+  +  +   V K++S F  +
+Sbjct: 5  QNILRHELIGLDLEVVKSTDSGLISTKGRVINETRNTLVLEKENGKEITVVKEISTFRID 64
+
+Query: 68 ---ADDGTKIKIPGERLVGRPEMRLKKRWKK 95
+             + D  K+ I G  LVGRPE RLK++ K+
+Sbjct: 65 FKNSGDVVKVDIDGRLLVGRPEDRLKRKIKQ 95
+
+
+>ref|YP_331160.1| ribonuclease P protein component 1 [Natronomonas pharaonis DSM
+          2160]
+ emb|CAI50526.1| ribonuclease P protein component 1 [Natronomonas pharaonis DSM
+          2160]
+          Length = 98
+
+ Score = 63.9 bits (154), Expect = 2e-009
+ Identities = 35/87 (40%), Positives = 51/87 (58%), Gaps = 6/87 (6%)
+
+Query: 12 IIWHELIGLRVRIVGSTHPAFVGIEGYVIDET-RNMLVIAGDRIWKVPKDVSIFEFEADD 70
+          ++ HEL+GL V +  + +P  VGI G V DET R +LV  GD + +VPK  + F FE D+
+Sbjct: 6  LVRHELVGLDVEVTDAPNPDLVGIAGRVHDETMRTLLVATGDGVKQVPKAETTFRFELDE 65
+
+Query: 71 -----GTKIKIPGERLVGRPEMRLKKR 92
+                  + + GERLV RP +R + +
+Sbjct: 66 AADNGSVAVVVEGERLVARPALRTETK 92
+
+
+>ref|YP_564783.1| Ribonuclease P subunit [Methanococcoides burtonii DSM 6242]
+ gb|ABE51033.1| Ribonuclease P subunit [Methanococcoides burtonii DSM 6242]
+          Length = 101
+
+ Score = 63.5 bits (153), Expect = 3e-009
+ Identities = 38/87 (43%), Positives = 53/87 (60%), Gaps = 7/87 (8%)
+
+Query: 11 NIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWK--VPKDVSIFEF-- 66
+          N+I+HELIGL   +  ST+P  + I G VIDETRNML+I  +   +  VPK+ + F F
+Sbjct: 7  NLIFHELIGLYAEVFESTNPKLINICGRVIDETRNMLIIETEDTHEKMVPKNGTTFVFHL 66
+
+Query: 67 ---EADDGTKIKIPGERLVGRPEMRLK 90
+              AD   ++KI G  L+ +PE R+K
+Sbjct: 67 PSSSADHDQRVKIFGTLLLSQPENRVK 93
+
+
+>ref|YP_001013483.1| ribonuclease P protein component 1 [Hyperthermus butylicus DSM
+          5456]
+ gb|ABM81138.1| ribonuclease P protein component 1 [Hyperthermus butylicus DSM
+          5456]
+          Length = 111
+
+ Score = 61.6 bits (148), Expect = 1e-008
+ Identities = 34/87 (39%), Positives = 54/87 (62%), Gaps = 4/87 (4%)
+
+Query: 8  TRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIA---GDRIWKVPKDVSIF 64
+          T  NI++H LIGLR R++ ++ P   G+EG V++ETR+ LV+    G R+ +V K  SIF
+Sbjct: 4  TAWNIVFHSLIGLRARVLATSDPGLRGLEGVVVEETRHSLVVETRDGRRV-RVLKANSIF 62
+
+Query: 65 EFEADDGTKIKIPGERLVGRPEMRLKK 91
+           F+   G+ + + GE + G    R+K+
+Sbjct: 63 LFQLPGGSWVVVRGEEIAGSLAERVKR 89
+
+
+>ref|NP_147179.1| ribonuclease P protein component 1 [Aeropyrum pernix K1]
+ sp|Q9YF79|RNP1_AERPE Ribonuclease P protein component 1 (RNase P component 1)
+ dbj|BAA79317.1| ribonuclease P protein component 1 [Aeropyrum pernix K1]
+          Length = 110
+
+ Score = 58.2 bits (139), Expect = 1e-007
+ Identities = 33/89 (37%), Positives = 57/89 (64%), Gaps = 3/89 (3%)
+
+Query: 9  RRNIIWHELIGLRVRIVGSTHPAFVGIEGYVI-DETRNMLVIAGD-RIWKVPKDVSIFEF 66
+          RR +I   L GLRV+++  + P+  G+EG+V+ +E R++ ++  + R+  V KD+++ E
+Sbjct: 9  RRQLIPPLLTGLRVKVLAHSDPSLEGLEGWVVVEEARSLRILTLEGRVSTVLKDLAVIEV 68
+
+Query: 67 EADDGTKIKIPGERLVGRPEMRLKK-RWK 94
+          EA  G  I+I G  L+G P  R+K+ RW+
+Sbjct: 69 EAPGGEYIRISGRVLIGNPLDRVKEYRWR 97
+
+
+>ref|YP_503669.1| Ribonuclease P subunit [Methanospirillum hungatei JF-1]
+ gb|ABD41950.1| Ribonuclease P subunit [Methanospirillum hungatei JF-1]
+          Length = 91
+
+ Score = 56.2 bits (134), Expect = 5e-007
+ Identities = 33/90 (36%), Positives = 49/90 (54%), Gaps = 1/90 (1%)
+
+Query: 7  VTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVI-AGDRIWKVPKDVSIFE 65
+          +T +NI+ HEL GL VR+  + +    GI G V+ ETR+M+ +  G  + KV K   IF
+Sbjct: 2  ITPQNILRHELTGLDVRVEQAQNQYLNGISGLVVRETRHMVFVKTGTGVKKVAKKGVIFR 61
+
+Query: 66 FEADDGTKIKIPGERLVGRPEMRLKKRWKK 95
+          F    G ++ + G  L   PE R+  R K+
+Sbjct: 62 FTLPSGKRVDVTGAVLDMAPEKRINMRIKR 91
+
+
+>gb|AAA86867.1| ribosomal protein
+          Length = 67
+
+ Score = 55.5 bits (132), Expect = 9e-007
+ Identities = 25/54 (46%), Positives = 36/54 (66%), Gaps = 1/54 (1%)
+
+Query: 15 HELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAG-DRIWKVPKDVSIFEFE 67
+          HEL+GL   +V +++P  +GI G V+ ET  ML + G DR+W VPKD + F F+
+Sbjct: 11 HELVGLDCEVVAASNPDVIGISGTVVMETTQMLTLEGADRVWHVPKDSATFAFD 64
+
+
+>gb|AAU84021.1| hypothetical protein GZ35D7_6 [uncultured archaeon GZfos35D7]
+          Length = 156
+
+ Score = 52.4 bits (124), Expect = 7e-006
+ Identities = 24/44 (54%), Positives = 32/44 (72%)
+
+Query: 7  VTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIA 50
+          +T  N+++H LIGL   + GST+P  VGI G VIDET+N LVI+
+Sbjct: 9  ITPENLVYHTLIGLEAVVSGSTNPDMVGIAGAVIDETKNTLVIS 52
+
+
+>sp|P60834|RNP1_SULTO Ribonuclease P protein component 1 (RNase P component 1)
+          Length = 77
+
+ Score = 51.2 bits (121), Expect = 2e-005
+ Identities = 27/79 (34%), Positives = 51/79 (64%), Gaps = 6/79 (7%)
+
+Query: 16 ELIGLRVRIVGSTHPAFVGIEGYVIDET-RNMLVIAGDRIWKVPKDVSIFEFEADDGTKI 74
+          +LIG +++++G + P+ +G EG ++ ET +  L+   ++I +V K   IFE  +++  K+
+Sbjct: 3  DLIGSKIKVLGHSDPSLIGREGIILFETKKTFLIQTQNKIIRVLKSNGIFEIYSEN-RKV 61
+
+Query: 75 KIPGERLVGRPEMRLKKRW 93
+           +PG +LVG    R++KRW
+Sbjct: 62 ILPGSKLVG----RIEKRW 76
+
+
+>ref|ZP_01709067.1| hypothetical protein Faci_03001135 [Ferroplasma acidarmanus fer1]
+          Length = 100
+
+ Score = 51.2 bits (121), Expect = 2e-005
+ Identities = 29/80 (36%), Positives = 47/80 (58%), Gaps = 1/80 (1%)
+
+Query: 16 ELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVI-AGDRIWKVPKDVSIFEFEADDGTKI 74
+          E IG  + +  S +   VGI+G +IDET+NM+ I  G +I  + K  +IF  E ++G
+Sbjct: 10 EFIGKNITVKNSHNIKNVGIKGKLIDETKNMMYIWNGSKICSIQKSGTIFGIEFNEGAHY 69
+
+Query: 75 KIPGERLVGRPEMRLKKRWK 94
+           I G+ ++ +PE R K++ K
+Sbjct: 70 DINGDAILIKPEDRTKEKRK 89
+
+
+>ref|YP_001190200.1| Ribonuclease P, Rpp29 [Metallosphaera sedula DSM 5348]
+ gb|ABP94276.1| Ribonuclease P, Rpp29 [Metallosphaera sedula DSM 5348]
+          Length = 84
+
+ Score = 50.8 bits (120), Expect = 2e-005
+ Identities = 31/83 (37%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
+
+Query: 9  RRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDET-RNMLVIAGDRIWKVPKDVSIFEFE 67
+          +   + ++LIG RVRI+  + P+ VG EG +I ET +  LV AGD  + V K   I+E +
+Sbjct: 3  KNRFLEYDLIGKRVRILTHSDPSLVGREGIIILETEKTFLVKAGDNAFSVYKPNGIYEID 62
+
+Query: 68 ADDGTKIKIPGERLVGRPEMRLK 90
+               ++ I G+ L+G+P  RL+
+Sbjct: 63 F-KRRRLTICGDALIGKPIKRLR 84
+
+
+>gb|ABK77498.1| RNase P/RNase MRP subunit p29 [Cenarchaeum symbiosum]
+          Length = 80
+
+ Score = 50.4 bits (119), Expect = 3e-005
+ Identities = 35/87 (40%), Positives = 47/87 (54%), Gaps = 10/87 (11%)
+
+Query: 7  VTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVI--AGDRIWKVPKDVSIF 64
+          +T+ NI  HEL+GL     G         EG VIDET+NM+++  A  RI  +PK   ++
+Sbjct: 2  ITQENIRLHELVGLAASASGYIR------EGMVIDETKNMILLDTAAGRI-MLPKAGRLW 54
+
+Query: 65 EFEADDGTKIKIPGERLVGRPEMRLKK 91
+           F A   T   + GE L GRP  RLK+
+Sbjct: 55 RF-ASGRTSCTVQGESLAGRPHERLKR 80
+
+
+>ref|NP_280464.1| hypothetical protein VNG1699C [Halobacterium sp. NRC-1]
+ sp|O24785|RNP1_HALSA Ribonuclease P protein component 1 (RNase P component 1)
+ dbj|BAA22278.1| unnamed protein product [Halobacterium salinarum]
+ gb|AAG19944.1| conserved hypothetical protein [Halobacterium sp. NRC-1]
+          Length = 123
+
+ Score = 46.6 bits (109), Expect = 4e-004
+ Identities = 34/110 (30%), Positives = 48/110 (43%), Gaps = 28/110 (25%)
+
+Query: 7   VTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVI-AGDRIWKVPKDVSIFE 65
+           +T  ++  HEL+GL  R+   T  + VGI G V+DET   +V+     + +VPK  + FE
+Sbjct: 4   ITPESLPRHELLGLHARVAADTDQSRVGIAGRVVDETMQTVVLRTASGVAQVPKKGATFE 63
+
+Query: 66  FEADD---------GTKIK------------------IPGERLVGRPEMR 88
+           F   D         GT  K                  + G RL+ RPE R
+Sbjct: 64  FRLTDEAAAPDNGVGTAFKPAGGETRQTTGESVAYVTVDGGRLLSRPERR 113
+
+
+>ref|NP_070742.1| hypothetical protein AF1917 [Archaeoglobus fulgidus DSM 4304]
+ sp|O28362|RNP1_ARCFU Ribonuclease P protein component 1 (RNase P component 1) (aRpp29)
+ pdb|1TSF|A Chain A, Crystal Structure Of The Archaeal Homolog Of Human Rnase
+          P Protein Rpp29 From Archaeoglobus Fulgidus
+ gb|AAB89336.1| conserved hypothetical protein [Archaeoglobus fulgidus DSM 4304]
+          Length = 102
+
+ Score = 45.1 bits (105), Expect = 0.001
+ Identities = 31/88 (35%), Positives = 48/88 (54%)
+
+Query: 4  RGRVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWKVPKDVSI 63
+          RGR+    +I  + IGL V +V S + + VGI+G V+DET+N L I  ++  KV
+Sbjct: 2  RGRLQGVELIARDWIGLMVEVVESPNHSEVGIKGEVVDETQNTLKIMTEKGLKVVAKRGR 61
+
+Query: 64 FEFEADDGTKIKIPGERLVGRPEMRLKK 91
+                 G  ++I G+ +  RPE R+K+
+Sbjct: 62 TFRVWYKGKIMRIKGDLINFRPEDRIKR 89
+
+
+>ref|XP_001123127.1| PREDICTED: similar to CG8038-PA [Apis mellifera]
+          Length = 181
+
+ Score = 44.3 bits (103), Expect = 0.002
+ Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 3/78 (3%)
+
+Query: 19  GLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAG--DRIWKVPKDVSIFEFEADDGTKIKI 76
+           G  + IVGS  P+ +G++G +I +T+N   I G  + I  +PKDV I      +  K++
+Sbjct: 102 GAEISIVGSKCPSLIGLKGIIIQDTKNTFKICGTDNIIRTIPKDVIIMNIYLKE-VKLEF 160
+
+Query: 77  PGERLVGRPEMRLKKRWK 94
+            G+ L  RP  R  K++K
+Sbjct: 161 FGKDLSIRPTERTIKKFK 178
+
+
+>pdb|1TS9|A Chain A, Crystal Structure Of The Archaeal Homolog Of Human Rnase
+          P Protein Rpp29 From Archaeoglobus Fulgidus
+          Length = 102
+
+ Score = 44.3 bits (103), Expect = 0.002
+ Identities = 31/88 (35%), Positives = 47/88 (53%)
+
+Query: 4  RGRVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWKVPKDVSI 63
+          RGR+    +I  + IGL V +V S + + VGI+G V+DET+N L I  ++  KV
+Sbjct: 2  RGRLQGVELIARDWIGLXVEVVESPNHSEVGIKGEVVDETQNTLKIXTEKGLKVVAKRGR 61
+
+Query: 64 FEFEADDGTKIKIPGERLVGRPEMRLKK 91
+                 G   +I G+ +  RPE R+K+
+Sbjct: 62 TFRVWYKGKIXRIKGDLINFRPEDRIKR 89
+
+
+>ref|XP_969337.1| PREDICTED: similar to CG8038-PA [Tribolium castaneum]
+          Length = 221
+
+ Score = 43.9 bits (102), Expect = 0.003
+ Identities = 26/81 (32%), Positives = 45/81 (55%), Gaps = 3/81 (3%)
+
+Query: 16  ELIGLRVRIVGSTHPAFVGIEGYVIDETRN--MLVIAGDRIWKVPKDVSIFEFEADDGTK 73
+           ELIG  +++  S  P+ VG+ G V+ ET+    +V    ++  +PK+ S+FEF   D  K
+Sbjct: 135 ELIGSEIKVARSKCPSHVGLTGTVVLETKMTFQIVTQQSQLKIIPKNTSVFEFVL-DAMK 193
+
+Query: 74  IKIPGERLVGRPEMRLKKRWK 94
+             + G+ ++ +P  R  K+ K
+Sbjct: 194 FTVFGKHIMTKPSERSVKKIK 214
+
+
+>ref|NP_110852.1| RNAse P protein subunit p29 [Thermoplasma volcanium GSS1]
+ sp|Q97BW8|RNP1_THEVO Ribonuclease P protein component 1 (RNase P component 1)
+ dbj|BAB59479.1| hypothetical protein [Thermoplasma volcanium GSS1]
+          Length = 89
+
+ Score = 40.4 bits (93), Expect = 0.029
+ Identities = 29/77 (37%), Positives = 40/77 (51%), Gaps = 5/77 (6%)
+
+Query: 16 ELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIA-GDRIWKVPKDVSIFEFEADDGTKI 74
+          E IG  V ++ S++   VGI G V  ET+N   I  G     VPK+  IF F+     K
+Sbjct: 6  EFIGRHVEVIQSSNRYDVGISGQVSFETKNTFEITKGTGKVIVPKEGRIFTFDG----KF 61
+
+Query: 75 KIPGERLVGRPEMRLKK 91
+          K+ G  +  RPE RL++
+Sbjct: 62 KVDGSLINYRPEDRLRE 78
+
+
+>ref|XP_665916.1| POP4 (processing of precursor , S. cerevisiae) [Cryptosporidium
+           hominis TU502]
+ gb|EAL35684.1| POP4 (processing of precursor , S. cerevisiae) [Cryptosporidium
+           hominis]
+          Length = 270
+
+ Score = 40.4 bits (93), Expect = 0.029
+ Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 2/87 (2%)
+
+Query: 10  RNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVI--AGDRIWKVPKDVSIFEFE 67
+           +N+   +L G  + ++ S + + V I+G V+ ET+   VI  A D++  + K  SIF
+Sbjct: 175 QNLSQADLHGSMISVISSRNKSCVNIQGIVVKETKETFVIISADDKVRTILKGQSIFGIV 234
+
+Query: 68  ADDGTKIKIPGERLVGRPEMRLKKRWK 94
+             +   + I G +L   P  R+K +++
+Sbjct: 235 ISNNYLVTIYGSQLCYHPYERIKHKFR 261
+
+
+>ref|XP_784253.2| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
+ ref|XP_001189296.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
+          Length = 279
+
+ Score = 39.3 bits (90), Expect = 0.064
+ Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 3/80 (3%)
+
+Query: 17  LIGLRVRIVGSTHPAFVGIEGYVIDETRN--MLVIAGDRIWKVPKDVSIFEFEADDGTKI 74
+           L+   + +  S  PA+VGI G ++ ETRN   ++   +++  +PK    F F  D    I
+Sbjct: 194 LLSKTLTVTRSKCPAYVGISGILLQETRNTFKVITKENKMKTIPKSQCWFMFTVDQ-YAI 252
+
+Query: 75  KIPGERLVGRPEMRLKKRWK 94
+            I G+    R  MR  K++K
+Sbjct: 253 TIYGQHFCQRSSMRAAKKFK 272
+
+
+>ref|XP_001388661.1| hypothetical protein An01g02230 [Aspergillus niger]
+ emb|CAK43593.1| unnamed protein product [Aspergillus niger]
+          Length = 242
+
+ Score = 38.9 bits (89), Expect = 0.084
+ Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 7/68 (10%)
+
+Query: 19  GLRVRIVGSTHPAFVGIEGYVIDETRNMLVIA--GDRIWKVPKDVSIFEF-----EADDG 71
+           G  V +V S     VG++G V+ +T+   V+   GD +  +PK+ +IF F     EADD
+Sbjct: 136 GAEVEVVRSRCEGRVGVKGIVVRDTKFTFVVVTRGDEVKTIPKEQTIFRFSVPLPEADDA 195
+
+Query: 72  TKIKIPGE 79
+               + GE
+Sbjct: 196 DGAAVTGE 203
+
+
+>ref|YP_255274.1| hypothetical protein Saci_0589 [Sulfolobus acidocaldarius DSM
+          639]
+ gb|AAY79981.1| conserved protein [Sulfolobus acidocaldarius DSM 639]
+          Length = 69
+
+ Score = 38.9 bits (89), Expect = 0.084
+ Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 2/62 (3%)
+
+Query: 28 THPAFVGIEGYVIDETRNMLVI-AGDRIWKVPKDVSIFEFEADDGTKIKIPGERLVGRPE 86
+          T P  VG EG VI++T N  +I +  R   V K   +F+  +  G    +PG +L+G+PE
+Sbjct: 4  TDPTLVGKEGLVIEDTENAFMIGSNSRKILVIKQNGLFQI-STKGKIFVVPGTKLIGKPE 62
+
+Query: 87 MR 88
+           R
+Sbjct: 63 KR 64
+
+
+>ref|YP_658544.1| Ribonuclease P protein component 1 (RNase P component 1)
+          [Haloquadratum walsbyi DSM 16790]
+ emb|CAJ52941.1| Ribonuclease P protein component 1 (RNase P component 1)
+          [Haloquadratum walsbyi DSM 16790]
+          Length = 228
+
+ Score = 37.7 bits (86), Expect = 0.19
+ Identities = 18/43 (41%), Positives = 25/43 (58%)
+
+Query: 7  VTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVI 49
+          +T   +  HELIGL V +  + +P  +GI G V+DET   L I
+Sbjct: 3  LTPETLTRHELIGLYVAVADAANPDLIGISGRVVDETMQTLHI 45
+
+
+>ref|XP_626662.1| POP4 like ribonuclease P protein subunit [Cryptosporidium parvum
+           Iowa II]
+ gb|EAK89186.1| POP4 like ribonuclease P protein subunit [Cryptosporidium parvum
+           Iowa II]
+          Length = 270
+
+ Score = 37.0 bits (84), Expect = 0.32
+ Identities = 22/87 (25%), Positives = 45/87 (51%), Gaps = 2/87 (2%)
+
+Query: 10  RNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVI--AGDRIWKVPKDVSIFEFE 67
+           +N+   +L G  + ++ S + + V ++G V+ ET+   VI  A +++  + K  SIF
+Sbjct: 175 QNLSQADLHGSMISVISSRNISCVNVQGIVVKETKETFVIISADNKVRTILKSQSIFGIV 234
+
+Query: 68  ADDGTKIKIPGERLVGRPEMRLKKRWK 94
+             +   + I G +L   P  R+K +++
+Sbjct: 235 ISNNYLVTIYGSQLCYHPCERIKHKFR 261
+
+
+>gb|EAT48803.1| ribonuclease P, 29kD-subunit, putative [Aedes aegypti]
+          Length = 206
+
+ Score = 36.6 bits (83), Expect = 0.41
+ Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 3/78 (3%)
+
+Query: 19  GLRVRIVGSTHPAFVGIEGYVIDETRN--MLVIAGDRIWKVPKDVSIFEFEADDGTKIKI 76
+           G ++ +V + +P+ VGI G VI ET+    +V   +++  +PK  S+F    ++   + I
+Sbjct: 122 GAKISVVRTKNPSLVGIRGIVILETKGTFKVVSKDNKVRTIPKMDSVFVIHWNN-VDVTI 180
+
+Query: 77  PGERLVGRPEMRLKKRWK 94
+            G++L  RP  R  K+ K
+Sbjct: 181 FGKQLNSRPAERSVKKVK 198
+
+
+>gb|AAT10156.1| RNaseE subunit P29 [uncultured marine group II euryarchaeote
+          DeepAnt-JyKC7]
+          Length = 85
+
+ Score = 36.6 bits (83), Expect = 0.41
+ Identities = 21/78 (26%), Positives = 42/78 (53%), Gaps = 8/78 (10%)
+
+Query: 21 RVRIVGSTHPAFVGIEGYVIDETRNML---VIAGDRIWKVPKDVSIFEFEADDGTKIKIP 77
+          ++ ++ S+ P  VG+ G +++ETR  L    ++G+    + KDV  F     D  ++ I
+Sbjct: 12 QIEVIESSDPTLVGVSGMIVEETRRTLRVRTMSGE--VTLAKDVITFTI---DPEQLAID 66
+
+Query: 78 GERLVGRPEMRLKKRWKK 95
+          G  +  RP  R+ +R+++
+Sbjct: 67 GSTVKQRPADRINRRYRR 84
+
+
+>gb|EAY93010.1| hypothetical protein OsI_014243 [Oryza sativa (indica
+           cultivar-group)]
+          Length = 954
+
+ Score = 36.2 bits (82), Expect = 0.54
+ Identities = 24/91 (26%), Positives = 43/91 (47%), Gaps = 10/91 (10%)
+
+Query: 3   HRGRVTRRNIIWHELIGLR-VRIVGSTHP--------AFVG-IEGYVIDETRNMLVIAGD 52
+           ++GR+  RN  W  L  LR +R++  THP         F   ++  ++D ++N+++
+Sbjct: 399 NKGRIWSRNFAWRRLKNLRKLRVIEPTHPWGNKGEIDEFADMLKLEILDLSKNIMIQVLP 458
+
+Query: 53  RIWKVPKDVSIFEFEADDGTKIKIPGERLVG 83
+               +P  +  F F + +G K KI    L G
+Sbjct: 459 SYVGLPPSLESFSFASREGNKAKISSISLAG 489
+
+
+>ref|NP_001017252.1| hypothetical protein LOC550006 [Xenopus tropicalis]
+          Length = 219
+
+ Score = 36.2 bits (82), Expect = 0.54
+ Identities = 23/91 (25%), Positives = 47/91 (51%), Gaps = 3/91 (3%)
+
+Query: 6   RVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNM--LVIAGDRIWKVPKDVSI 63
+           ++ +  ++  +L G  + +  S  P++VG++G ++ ET+++   +   D++  VPK   +
+Sbjct: 123 QMIQNKLLKADLHGALLTVAKSKCPSYVGLQGIILQETKHVFKFITKDDKLKTVPKLNCV 182
+
+Query: 64  FEFEADDGTKIKIPGERLVGRPEMRLKKRWK 94
+           F  E  DG    I G +   R   R  K++K
+Sbjct: 183 FSVEI-DGFISYIYGSKFQMRSSERSAKKFK 212
+
+
+>ref|NP_001009642.1| processing of precursor 4, ribonuclease P/MRP family [Rattus
+           norvegicus]
+ sp|Q5M882|RP29_RAT Ribonuclease P protein subunit p29
+ gb|AAH88183.1| Processing of precursor 4, ribonuclease P/MRP family, (S.
+           cerevisiae) [Rattus norvegicus]
+          Length = 221
+
+ Score = 36.2 bits (82), Expect = 0.54
+ Identities = 22/81 (27%), Positives = 41/81 (50%), Gaps = 3/81 (3%)
+
+Query: 16  ELIGLRVRIVGSTHPAFVGIEGYVIDETRNM--LVIAGDRIWKVPKDVSIFEFEADDGTK 73
+           +L G  + +  S  P++VG+ G ++ ET+++  ++   D +  +PK   +F  E DD
+Sbjct: 135 DLHGAVISVTKSKCPSYVGVTGILLQETKHVFKIITKEDHLKVIPKQNCVFTIEIDDFIS 194
+
+Query: 74  IKIPGERLVGRPEMRLKKRWK 94
+             I G +   R   R  K++K
+Sbjct: 195 Y-IYGSKFQLRASERSAKKFK 214
+
+
+>ref|XP_001010353.2| hypothetical protein TTHERM_01005330 [Tetrahymena thermophila
+           SB210]
+ gb|EAR90108.2| hypothetical protein TTHERM_01005330 [Tetrahymena thermophila
+           SB210]
+          Length = 289
+
+ Score = 35.4 bits (80), Expect = 0.92
+ Identities = 24/81 (29%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
+
+Query: 16  ELIGLRVRIVGSTHPAFVGIEGYVIDETRNM--LVIAGDRIWKVPKDVSIFEFEADDGTK 73
+           +L G  ++I+ S   ++ G++G V+ E      ++   D+I  V K  S+F FE
+Sbjct: 197 DLHGSIIQILTSKCQSYEGMQGIVLQEKLKSFRVITQEDKIITVIKQNSVFLFEVYPQRI 256
+
+Query: 74  IKIPGERLVGRPEMRLKKRWK 94
+            K+ G  L+ RP  R+K+++K
+Sbjct: 257 FKVYGCHLMIRPSDRIKQKFK 277
+
+
+>ref|XP_001149011.1| PREDICTED: similar to ribonuclease P protein subunit p29 isoform 2
+           [Pan troglodytes]
+ ref|XP_001149087.1| PREDICTED: similar to ribonuclease P protein subunit p29 isoform 3
+           [Pan troglodytes]
+          Length = 179
+
+ Score = 35.4 bits (80), Expect = 0.92
+ Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 3/81 (3%)
+
+Query: 16  ELIGLRVRIVGSTHPAFVGIEGYVIDETRNM--LVIAGDRIWKVPKDVSIFEFEADDGTK 73
+           +L G  + +  S  P++VGI G ++ ET+++  ++   DR+  +PK   +F  E  DG
+Sbjct: 93  DLHGAIISVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVET-DGFI 151
+
+Query: 74  IKIPGERLVGRPEMRLKKRWK 94
+             I G +   R   R  K++K
+Sbjct: 152 SYIYGSKFQLRSSERSAKKFK 172
+
+
+>ref|XP_001149162.1| PREDICTED: similar to Pop4 protein isoform 4 [Pan troglodytes]
+          Length = 207
+
+ Score = 35.4 bits (80), Expect = 0.92
+ Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 3/81 (3%)
+
+Query: 16  ELIGLRVRIVGSTHPAFVGIEGYVIDETRNM--LVIAGDRIWKVPKDVSIFEFEADDGTK 73
+           +L G  + +  S  P++VGI G ++ ET+++  ++   DR+  +PK   +F  E  DG
+Sbjct: 121 DLHGAIISVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVET-DGFI 179
+
+Query: 74  IKIPGERLVGRPEMRLKKRWK 94
+             I G +   R   R  K++K
+Sbjct: 180 SYIYGSKFQLRSSERSAKKFK 200
+
+
+>ref|XP_512983.2| PREDICTED: POP4 (processing of precursor , S. cerevisiae) homolog
+           isoform 6 [Pan troglodytes]
+          Length = 220
+
+ Score = 35.4 bits (80), Expect = 0.92
+ Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 3/81 (3%)
+
+Query: 16  ELIGLRVRIVGSTHPAFVGIEGYVIDETRNM--LVIAGDRIWKVPKDVSIFEFEADDGTK 73
+           +L G  + +  S  P++VGI G ++ ET+++  ++   DR+  +PK   +F  E  DG
+Sbjct: 134 DLHGAIISVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVET-DGFI 192
+
+Query: 74  IKIPGERLVGRPEMRLKKRWK 94
+             I G +   R   R  K++K
+Sbjct: 193 SYIYGSKFQLRSSERSAKKFK 213
+
+
+>ref|XP_001149225.1| PREDICTED: similar to Pop4 protein isoform 5 [Pan troglodytes]
+          Length = 249
+
+ Score = 35.4 bits (80), Expect = 0.92
+ Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 3/81 (3%)
+
+Query: 16  ELIGLRVRIVGSTHPAFVGIEGYVIDETRNM--LVIAGDRIWKVPKDVSIFEFEADDGTK 73
+           +L G  + +  S  P++VGI G ++ ET+++  ++   DR+  +PK   +F  E  DG
+Sbjct: 163 DLHGAIISVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVET-DGFI 221
+
+Query: 74  IKIPGERLVGRPEMRLKKRWK 94
+             I G +   R   R  K++K
+Sbjct: 222 SYIYGSKFQLRSSERSAKKFK 242
+
+
+>gb|AAH74186.1| MGC82042 protein [Xenopus laevis]
+          Length = 223
+
+ Score = 35.4 bits (80), Expect = 0.92
+ Identities = 23/91 (25%), Positives = 47/91 (51%), Gaps = 3/91 (3%)
+
+Query: 6   RVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNM--LVIAGDRIWKVPKDVSI 63
+           ++ +  ++  +L G  + +  S  P++VG++G ++ ET+++   +   D++  VPK   +
+Sbjct: 127 QMIQNKLLKADLHGALLTVAKSKCPSYVGLQGIILQETKHVFKFITKDDKLKIVPKLNCV 186
+
+Query: 64  FEFEADDGTKIKIPGERLVGRPEMRLKKRWK 94
+           F  E  DG    I G +   R   R  K++K
+Sbjct: 187 FSVEI-DGFISYIYGSKFQMRASERSAKKFK 216
+
+
+>gb|AAD00893.2| ribonuclease P protein subunit p29 [Homo sapiens]
+          Length = 220
+
+ Score = 35.4 bits (80), Expect = 0.92
+ Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 3/81 (3%)
+
+Query: 16  ELIGLRVRIVGSTHPAFVGIEGYVIDETRNM--LVIAGDRIWKVPKDVSIFEFEADDGTK 73
+           +L G  + +  S  P++VGI G ++ ET+++  ++   DR+  +PK   +F  E  DG
+Sbjct: 134 DLHGAIISVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVET-DGFI 192
+
+Query: 74  IKIPGERLVGRPEMRLKKRWK 94
+             I G +   R   R  K++K
+Sbjct: 193 SYIYGSKFQLRSSERSAKKFK 213
+
+
+>ref|NP_006618.1| POP4 (processing of precursor , S. cerevisiae) homolog [Homo
+           sapiens]
+ sp|O95707|RP29_HUMAN Ribonuclease P protein subunit p29 (hPOP4)
+ emb|CAB39167.1| Pop4 protein [Homo sapiens]
+ gb|AAH04438.1| Processing of precursor 4, ribonuclease P/MRP subunit (S.
+           cerevisiae) [Homo sapiens]
+ gb|AAH06098.1| Processing of precursor 4, ribonuclease P/MRP subunit (S.
+           cerevisiae) [Homo sapiens]
+ emb|CAG38806.1| POP4 [Homo sapiens]
+ gb|ABM83983.1| processing of precursor 4, ribonuclease P/MRP subunit (S.
+           cerevisiae) [synthetic construct]
+ gb|ABM87306.1| processing of precursor 4, ribonuclease P/MRP subunit (S.
+           cerevisiae) [synthetic construct]
+          Length = 220
+
+ Score = 35.4 bits (80), Expect = 0.92
+ Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 3/81 (3%)
+
+Query: 16  ELIGLRVRIVGSTHPAFVGIEGYVIDETRNM--LVIAGDRIWKVPKDVSIFEFEADDGTK 73
+           +L G  + +  S  P++VGI G ++ ET+++  ++   DR+  +PK   +F  E  DG
+Sbjct: 134 DLHGAIISVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVET-DGFI 192
+
+Query: 74  IKIPGERLVGRPEMRLKKRWK 94
+             I G +   R   R  K++K
+Sbjct: 193 SYIYGSKFQLRSSERSAKKFK 213
+
+
+>ref|XP_001084400.1| PREDICTED: processing of precursor 4, ribonuclease P/MRP subunit
+           (S. cerevisiae) [Macaca mulatta]
+          Length = 221
+
+ Score = 35.0 bits (79), Expect = 1.2
+ Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 3/81 (3%)
+
+Query: 16  ELIGLRVRIVGSTHPAFVGIEGYVIDETRNM--LVIAGDRIWKVPKDVSIFEFEADDGTK 73
+           +L G  + +  S  P++VGI G ++ ET+++  ++   DR+  +PK   +F  E  DG
+Sbjct: 135 DLHGAIISVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVEI-DGFI 193
+
+Query: 74  IKIPGERLVGRPEMRLKKRWK 94
+             I G +   R   R  K++K
+Sbjct: 194 SYIYGSKFQLRSSERSAKKFK 214
+
+
+>sp|Q2KIB9|RPP29_BOVIN Ribonuclease P protein subunit p29
+ gb|AAI12696.1| POP4 protein [Bos taurus]
+          Length = 220
+
+ Score = 35.0 bits (79), Expect = 1.2
+ Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 3/81 (3%)
+
+Query: 16  ELIGLRVRIVGSTHPAFVGIEGYVIDETRNM--LVIAGDRIWKVPKDVSIFEFEADDGTK 73
+           +L G  V +  S  P++VG+ G ++ ET+++  ++   DR+  +PK   +F  E  DG
+Sbjct: 134 DLHGAIVSVTKSKCPSYVGVTGILLQETKHVFKIITKEDRLKVIPKLNCVFTVEI-DGFI 192
+
+Query: 74  IKIPGERLVGRPEMRLKKRWK 94
+             I G +   R   R  K++K
+Sbjct: 193 SYIYGSKFQLRSSERSAKKFK 213
+
+
+>ref|XP_855541.1| PREDICTED: similar to Ribonuclease P protein subunit p29 (hPOP4)
+           [Canis familiaris]
+          Length = 307
+
+ Score = 35.0 bits (79), Expect = 1.2
+ Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 3/81 (3%)
+
+Query: 16  ELIGLRVRIVGSTHPAFVGIEGYVIDETRNM--LVIAGDRIWKVPKDVSIFEFEADDGTK 73
+           +L G  + +  S  P++VG+ G ++ ET+++  ++   DR+  +PK   +F  E  DG
+Sbjct: 221 DLHGALISVTKSKCPSYVGVTGILLQETKHVFKIITKEDRLKVIPKLNCVFTVEI-DGFI 279
+
+Query: 74  IKIPGERLVGRPEMRLKKRWK 94
+             I G +   R   R  K++K
+Sbjct: 280 SYIYGSKFQLRSSERSAKKFK 300
+
+
+>ref|NP_001029942.1| POP4 (processing of precursor , S. cerevisiae) homolog [Bos taurus]
+ gb|AAX46326.1| POP4 (processing of precursor , S. cerevisiae) homolog [Bos taurus]
+          Length = 182
+
+ Score = 35.0 bits (79), Expect = 1.2
+ Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 3/81 (3%)
+
+Query: 16  ELIGLRVRIVGSTHPAFVGIEGYVIDETRNM--LVIAGDRIWKVPKDVSIFEFEADDGTK 73
+           +L G  V +  S  P++VG+ G ++ ET+++  ++   DR+  +PK   +F  E  DG
+Sbjct: 96  DLHGAIVSVTKSKCPSYVGVTGILLQETKHVFKIITKEDRLKVIPKLNCVFTVEI-DGFI 154
+
+Query: 74  IKIPGERLVGRPEMRLKKRWK 94
+             I G +   R   R  K++K
+Sbjct: 155 SYIYGSKFQLRSSERSAKKFK 175
+
+
+>sp|Q5R7B0|RP29_PONPY Ribonuclease P protein subunit p29
+ emb|CAH92350.1| hypothetical protein [Pongo pygmaeus]
+          Length = 220
+
+ Score = 35.0 bits (79), Expect = 1.2
+ Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 3/81 (3%)
+
+Query: 16  ELIGLRVRIVGSTHPAFVGIEGYVIDETRNM--LVIAGDRIWKVPKDVSIFEFEADDGTK 73
+           +L G  + +  S  P++VGI G ++ ET+++  ++   DR+  +PK   +F  E  DG
+Sbjct: 134 DLHGAIISVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVEI-DGFI 192
+
+Query: 74  IKIPGERLVGRPEMRLKKRWK 94
+             I G +   R   R  K++K
+Sbjct: 193 SYIYGSKFQLRSSERSAKKFK 213
+
+
+>ref|XP_701926.2| PREDICTED: hypothetical protein [Danio rerio]
+          Length = 219
+
+ Score = 34.7 bits (78), Expect = 1.6
+ Identities = 23/91 (25%), Positives = 47/91 (51%), Gaps = 3/91 (3%)
+
+Query: 6   RVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNM--LVIAGDRIWKVPKDVSI 63
+           +V ++ ++  +  G  + +V S  P++VG+ G ++ E +++  L+   D++  +PK  S+
+Sbjct: 123 QVIQQKLLKADFHGAILTVVRSKCPSYVGLTGILVQELKHIFKLITKEDKLKVIPKRNSV 182
+
+Query: 64  FEFEADDGTKIKIPGERLVGRPEMRLKKRWK 94
+           F  E   G    I G +   R   R  K++K
+Sbjct: 183 FSVEV-GGFVSHIYGSKFELRSSERSAKKFK 212
+
+
+>ref|NP_001018585.1| processing of precursor 4, ribonuclease P/MRP subunit [Danio rerio]
+ gb|AAH95328.1| Processing of precursor 4, ribonuclease P/MRP subunit [Danio rerio]
+          Length = 219
+
+ Score = 34.7 bits (78), Expect = 1.6
+ Identities = 23/91 (25%), Positives = 47/91 (51%), Gaps = 3/91 (3%)
+
+Query: 6   RVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNM--LVIAGDRIWKVPKDVSI 63
+           +V ++ ++  +  G  + +V S  P++VG+ G ++ E +++  L+   D++  +PK  S+
+Sbjct: 123 QVIQQKLLKADFHGAILTVVRSKCPSYVGLTGILVQELKHIFKLITKEDKLKVIPKRNSV 182
+
+Query: 64  FEFEADDGTKIKIPGERLVGRPEMRLKKRWK 94
+           F  E   G    I G +   R   R  K++K
+Sbjct: 183 FSVEV-GGFVSHIYGSKFELRSSERSAKKFK 212
+
+
+>ref|NP_079666.1| POP4 (processing of precursor , S. cerevisiae) homolog [Mus
+           musculus]
+ sp|Q9CR08|RPP29_MOUSE Ribonuclease P protein subunit p29
+ dbj|BAB22410.1| unnamed protein product [Mus musculus]
+ dbj|BAB22696.1| unnamed protein product [Mus musculus]
+ gb|AAH11465.1| Pop4 protein [Mus musculus]
+ dbj|BAE29579.1| unnamed protein product [Mus musculus]
+ dbj|BAE31617.1| unnamed protein product [Mus musculus]
+          Length = 221
+
+ Score = 34.7 bits (78), Expect = 1.6
+ Identities = 22/81 (27%), Positives = 41/81 (50%), Gaps = 3/81 (3%)
+
+Query: 16  ELIGLRVRIVGSTHPAFVGIEGYVIDETRNM--LVIAGDRIWKVPKDVSIFEFEADDGTK 73
+           +L G  + +  S  P++VG+ G ++ ET+++  ++   D +  +PK   +F  E DD
+Sbjct: 135 DLHGAIISVTKSKCPSYVGVTGILLQETKHVFKIITREDHLKVIPKLNCVFTIEIDDFIS 194
+
+Query: 74  IKIPGERLVGRPEMRLKKRWK 94
+             I G +   R   R  K++K
+Sbjct: 195 Y-IYGSKFQLRASERSAKKFK 214
+
+
+>ref|XP_001231227.1| PREDICTED: similar to POP4 protein [Gallus gallus]
+          Length = 220
+
+ Score = 34.3 bits (77), Expect = 2.1
+ Identities = 23/91 (25%), Positives = 47/91 (51%), Gaps = 3/91 (3%)
+
+Query: 6   RVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNM--LVIAGDRIWKVPKDVSI 63
+           ++ +  ++  +L G  V +  S  P++VGI G ++ E +++  ++   +++  VPK  ++
+Sbjct: 124 QMVQSKLLKADLHGAIVTVTKSKCPSYVGITGIILQEFKHVFKIITKDNKLKVVPKMNNV 183
+
+Query: 64  FEFEADDGTKIKIPGERLVGRPEMRLKKRWK 94
+           F  E  DG    I G +   R   R  K++K
+Sbjct: 184 FSLET-DGFISYIYGSKFQFRASERSAKKFK 213
+
+
+>ref|XP_414118.2| PREDICTED: similar to POP4 protein [Gallus gallus]
+          Length = 220
+
+ Score = 34.3 bits (77), Expect = 2.1
+ Identities = 23/91 (25%), Positives = 47/91 (51%), Gaps = 3/91 (3%)
+
+Query: 6   RVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNM--LVIAGDRIWKVPKDVSI 63
+           ++ +  ++  +L G  V +  S  P++VGI G ++ E +++  ++   +++  VPK  ++
+Sbjct: 124 QMVQSKLLKADLHGAIVTVTKSKCPSYVGITGIILQEFKHVFKIITKDNKLKVVPKMNNV 183
+
+Query: 64  FEFEADDGTKIKIPGERLVGRPEMRLKKRWK 94
+           F  E  DG    I G +   R   R  K++K
+Sbjct: 184 FSLET-DGFISYIYGSKFQFRASERSAKKFK 213
+
+
+>ref|NP_493083.1| C15C6.4 [Caenorhabditis elegans]
+ emb|CAB02730.1| Hypothetical protein C15C6.4 [Caenorhabditis elegans]
+          Length = 198
+
+ Score = 34.3 bits (77), Expect = 2.1
+ Identities = 26/84 (30%), Positives = 41/84 (48%), Gaps = 3/84 (3%)
+
+Query: 10  RNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRN--MLVIAGDRIWKVPKDVSIFEFE 67
+           + I+  +  G  + I  + +P  +GI G V+ ETR+   +V   DR   +PK  S+F F
+Sbjct: 91  KTILKSDYHGALLTIWLAENPTQIGISGIVVLETRHTFQMVTQEDRFVVIPKKGSVFRFI 150
+
+Query: 68  ADDGTKIKIPGERLVGRPEMRLKK 91
+             D     + G+ +  RP  R KK
+Sbjct: 151 LGD-RLFSLFGDGMRTRPAWRGKK 173
+
+
+>pdb|1PC0|A Chain A, Nmr Structure Of The Archaeal Homologue Of Rnase P
+          Protein Rpp29
+          Length = 61
+
+ Score = 33.9 bits (76), Expect = 2.7
+ Identities = 18/39 (46%), Positives = 26/39 (66%)
+
+Query: 19 GLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWKV 57
+          GL V +V S + + VGI+G V+DET+N L I  ++  KV
+Sbjct: 1  GLMVEVVESPNHSEVGIKGEVVDETQNTLKIMTEKGLKV 39
+
+
+>ref|XP_001259578.1| ribonuclease P complex subunit Pop4, putative [Neosartorya fischeri
+           NRRL 181]
+ gb|EAW17681.1| ribonuclease P complex subunit Pop4, putative [Neosartorya fischeri
+           NRRL 181]
+          Length = 236
+
+ Score = 33.5 bits (75), Expect = 3.5
+ Identities = 29/96 (30%), Positives = 43/96 (44%), Gaps = 20/96 (20%)
+
+Query: 19  GLRVRIVGSTHPAFVGIEGYVIDETRN--MLVIAGDRIWKVPKDVSIFEF-----EADD- 70
+           G  V +V S     VG++G V  +T+   M+V   D +  +PK+ +IF F      ADD
+Sbjct: 134 GAEVEVVRSRCAGRVGVKGIVARDTKFTFMIVTEKDEVKTIPKEQTIFRFTVPLPSADDE 193
+
+Query: 71  ------GTKIK------IPGERLVGRPEMRLKKRWK 94
+                 G K K      + G +   RP  R  K++K
+Sbjct: 194 DTAMSYGDKAKKALTFELHGSQFENRPVDRANKKFK 229
+
+
+>gb|EAT78680.1| hypothetical protein SNOG_14055 [Phaeosphaeria nodorum SN15]
+          Length = 229
+
+ Score = 32.7 bits (73), Expect = 6.0
+ Identities = 28/88 (31%), Positives = 48/88 (54%), Gaps = 9/88 (10%)
+
+Query: 16  ELIGLRVRIVGSTHPAFVGIEGYVIDETR-NMLVIAGDRIWK-VPKDVSIFEFE-ADDGT 72
+           ++ G  +RIV S   + VG+EG V+ +TR    +I  + + K +PK+ +IF+F  A +G
+Sbjct: 135 DMHGALLRIVRSRCVSRVGLEGIVVRDTRFTFEIITKNNVVKAIPKEHTIFQFTIALEGG 194
+
+Query: 73  KIKIP------GERLVGRPEMRLKKRWK 94
+           + K P      GE+   R   R  K+++
+Sbjct: 195 EEKKPLVFEINGEQFQTRAPDRANKKFR 222
+
+
+>dbj|BAE60136.1| unnamed protein product [Aspergillus oryzae]
+          Length = 245
+
+ Score = 32.7 bits (73), Expect = 6.0
+ Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
+
+Query: 19  GLRVRIVGSTHPAFVGIEGYVIDETRNMLVIA--GDRIWKVPKDVSIFEF 66
+           G  V +V S     VG+ G V+ +T+   V+   GD +  +PK+ +IF F
+Sbjct: 137 GAEVEVVRSRCAGRVGVRGIVVRDTKFTFVVVTEGDEVKTLPKEQTIFRF 186
+
+
+>ref|XP_766695.1| hypothetical protein TP01_1174 [Theileria parva strain Muguga]
+ gb|EAN34412.1| hypothetical protein TP01_1174 [Theileria parva]
+          Length = 253
+
+ Score = 32.7 bits (73), Expect = 6.0
+ Identities = 21/81 (25%), Positives = 43/81 (53%), Gaps = 3/81 (3%)
+
+Query: 16  ELIGLRVRIVGSTHPAFVGIEGYVIDETRN--MLVIAGDRIWKVPKDVSIFEFEADDGTK 73
+           +L G  + +V S   ++VG+ G V+ ET+N   +V   D++  + K+ S+F+   ++ +
+Sbjct: 169 DLHGSLLEVVKSNCTSYVGVTGIVLKETQNGFSIVDKEDKVRFILKNSSVFKLNYEEWS- 227
+
+Query: 74  IKIPGERLVGRPEMRLKKRWK 94
+             I G+ ++     R K + K
+Sbjct: 228 FFIHGKHIMASASQRTKNKLK 248
+
+
+>ref|XP_001274409.1| ribonuclease P complex subunit Pop4, putative [Aspergillus clavatus
+           NRRL 1]
+ gb|EAW12983.1| ribonuclease P complex subunit Pop4, putative [Aspergillus clavatus
+           NRRL 1]
+          Length = 237
+
+ Score = 32.3 bits (72), Expect = 7.8
+ Identities = 27/96 (28%), Positives = 42/96 (43%), Gaps = 20/96 (20%)
+
+Query: 19  GLRVRIVGSTHPAFVGIEGYVIDETRN--MLVIAGDRIWKVPKDVSIFEF---------- 66
+           G  V +V S     VG++G V+ +T+   M+V   D +  +PK+ +IF F
+Sbjct: 135 GAEVEVVRSRCAGRVGMKGIVVRDTKFTFMIVTEKDEMKTIPKEQTIFRFFVPLPIREDG 194
+
+Query: 67  ---EADDGTKIK-----IPGERLVGRPEMRLKKRWK 94
+                DD T  K     + G +   RP  R  K++K
+Sbjct: 195 DTAMTDDDTASKKLTFELHGSQFENRPVDRANKKFK 230
+
+
+  Database: All non-redundant GenBank CDS
+  translations+PDB+SwissProt+PIR+PRF excluding environmental samples
+  from WGS projects
+    Posted date:  May 9, 2007  5:55 PM
+  Number of letters in database: 1,693,139,330
+  Number of sequences in database:  4,904,269
+
+Lambda     K      H
+   0.324    0.144    0.000
+
+Gapped
+Lambda     K      H
+   0.267   0.0410 4.94e-324
+
+Matrix: BLOSUM62
+Gap Penalties: Existence: 11, Extension: 1
+Number of Sequences: 4904269
+Number of Hits to DB: 17321271
+Number of extensions: 662023
+Number of successful extensions: 1350
+Number of sequences better than 10: 2
+Number of HSP's better than 10 without gapping: 0
+Number of HSP's gapped: 1356
+Number of HSP's successfully gapped: 2
+Length of query: 96
+Length of database: 1693139330
+Length adjustment: 65
+Effective length of query: 31
+Effective length of database: 1374361845
+Effective search space: 42605217195
+Effective search space used: 42605217195
+T: 11
+A: 40
+X1: 15 (7.0 bits)
+X2: 38 (14.6 bits)
+X3: 64 (24.7 bits)
+S1: 41 (20.4 bits)
+S2: 72 (32.3 bits)
+
diff --git a/geneWKspace/Genetegrate/ClientCopy2.blastpgp b/geneWKspace/Genetegrate/ClientCopy2.blastpgp
new file mode 100644
index 0000000..05e8072
--- /dev/null
+++ b/geneWKspace/Genetegrate/ClientCopy2.blastpgp
@@ -0,0 +1,5866 @@
+BLASTP 2.2.15 [Oct-15-2006]
+
+
+Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
+Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
+"Gapped BLAST and PSI-BLAST: a new generation of protein database search
+programs",  Nucleic Acids Res. 25:3389-3402.
+
+Query= gi|129295|sp|P01013|OVAX_CHICK GENE X PROTEIN
+(OVALBUMIN-RELATED)
+QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE
+         (162 letters)
+
+Database: All non-redundant GenBank CDS
+translations+PDB+SwissProt+PIR+PRF excluding environmental samples
+from WGS projects
+           4,904,269 sequences; 1,693,139,330 total letters
+
+
+
+                                                                 Score    E
+Sequences producing significant alignments:                      (bits) Value
+
+sp|P01013|OVALX_CHICK Ovalbumin-related protein X (Gene X protein)    324   1e-087
+ref|XP_418984.2| PREDICTED: similar to Ovalbumin-related protein...   319   3e-086
+emb|CAA23685.1| unnamed protein product [Gallus gallus]               270   2e-071
+ref|NP_001026172.1| serine (or cysteine) proteinase inhibitor, c...   253   3e-066
+pdb|1JTI|A Chain A, Loop-Inserted Structure Of P1-P1' Cleaved Ov...   216   3e-055
+sp|P01012|OVAL_CHICK Ovalbumin (Egg albumin) (Plakalbumin) (Alle...   215   5e-055
+ref|NP_990483.1| ovalbumin [Gallus gallus] >gi|808969|emb|CAA236...   215   5e-055
+pdb|1OVA|A Chain A, Ovalbumin (Egg Albumin) >gi|230202|pdb|1OVA|...   215   5e-055
+prf||0705172A ovalbumin                                               215   5e-055
+gb|AAO43266.1| ovalbumin [Gallus gallus]                              214   2e-054
+pdb|1UHG|A Chain A, Crystal Structure Of S-Ovalbumin At 1.9 Angs...   209   3e-053
+sp|O73860|OVAL_MELGA Ovalbumin (Egg albumin) >gi|3136338|gb|AAC1...   209   5e-053
+sp|Q6V115|OVAL_COTCO Ovalbumin (Egg albumin) >gi|33590487|gb|AAQ...   204   2e-051
+sp|P19104|OVAL_COTJA Ovalbumin (Egg albumin) >gi|62644|emb|CAA37...   202   6e-051
+ref|XP_588377.2| PREDICTED: similar to SCCA2/SCCA1 fusion protei...   164   1e-039
+ref|XP_001331039.1| PREDICTED: hypothetical protein [Danio rerio]     163   2e-039
+ref|XP_697505.2| PREDICTED: similar to serine proteinase inhibit...   163   3e-039
+ref|XP_001338768.1| PREDICTED: similar to Serpin peptidase inhib...   162   5e-039
+ref|NP_001009892.1| serpin peptidase inhibitor, clade B (ovalbum...   161   9e-039
+ref|XP_001254097.1| PREDICTED: similar to squamous cell carcinom...   160   2e-038
+ref|NP_956235.1| serpin peptidase inhibitor, clade B (ovalbumin)...   156   3e-037
+ref|XP_001254054.1| PREDICTED: similar to SCCA2/SCCA1 fusion pro...   156   4e-037
+ref|XP_001254469.1| PREDICTED: similar to squamous cell carcinom...   155   8e-037
+emb|CAF98804.1| unnamed protein product [Tetraodon nigroviridis]      154   1e-036
+ref|XP_001254815.1| PREDICTED: similar to SCCA2/SCCA1 fusion pro...   154   1e-036
+ref|XP_597345.3| PREDICTED: similar to squamous cell carcinoma a...   153   3e-036
+ref|XP_001365788.1| PREDICTED: similar to SERPINB11d [Monodelphi...   152   7e-036
+ref|XP_589083.3| PREDICTED: similar to SCCA2/SCCA1 fusion protei...   151   9e-036
+ref|XP_001148581.1| PREDICTED: serine (or cysteine) proteinase i...   151   9e-036
+ref|XP_001148652.1| PREDICTED: serine (or cysteine) proteinase i...   151   9e-036
+sp|P80229|ILEU_PIG Leukocyte elastase inhibitor (LEI) (Serpin B1...   151   9e-036
+ref|NP_005015.1| serine (or cysteine) proteinase inhibitor, clad...   151   9e-036
+ref|NP_035589.1| serine (or cysteine) proteinase inhibitor, clad...   151   9e-036
+ref|XP_001254391.1| PREDICTED: similar to squamous cell carcinom...   151   1e-035
+ref|XP_001253954.1| PREDICTED: similar to SCCA2/SCCA1 fusion pro...   151   1e-035
+gb|AAH96218.1| Serpin peptidase inhibitor, clade B (ovalbumin), ...   151   1e-035
+ref|XP_001254421.1| PREDICTED: similar to SCCA2/SCCA1 fusion pro...   150   2e-035
+gb|ABC70735.1| SERPINB4 [Papio papio]                                 150   2e-035
+ref|XP_856912.1| PREDICTED: similar to serine (or cysteine) prot...   150   2e-035
+ref|XP_848751.1| PREDICTED: similar to serine (or cysteine) prot...   150   2e-035
+ref|XP_856828.1| PREDICTED: similar to serine (or cysteine) prot...   150   2e-035
+ref|XP_856871.1| PREDICTED: similar to serine (or cysteine) prot...   150   2e-035
+gb|AAI30371.1| SERPINB11 protein [Homo sapiens] >gi|120660348|gb...   150   3e-035
+ref|XP_001232382.1| PREDICTED: similar to Chain A, Crystal Struc...   150   3e-035
+ref|XP_426040.1| PREDICTED: similar to Chain A, Crystal Structur...   150   3e-035
+dbj|BAE28539.1| unnamed protein product [Mus musculus]                150   3e-035
+ref|XP_001090785.1| PREDICTED: serine (or cysteine) proteinase i...   149   4e-035
+gb|AAH96217.1| Serpin peptidase inhibitor, clade B (ovalbumin), ...   149   4e-035
+pir||S38962 serpin - pig                                              149   4e-035
+ref|XP_523958.2| PREDICTED: serine (or cysteine) proteinase inhi...   149   5e-035
+ref|XP_001056957.1| PREDICTED: similar to serine (or cysteine) p...   149   5e-035
+ref|XP_222490.4| PREDICTED: similar to serine (or cysteine) prot...   149   5e-035
+ref|XP_545313.2| PREDICTED: similar to serine (or cysteine) prot...   149   5e-035
+ref|XP_001147820.1| PREDICTED: serine (or cysteine) proteinase i...   149   6e-035
+ref|XP_001147882.1| PREDICTED: similar to leupin precursor - hum...   149   6e-035
+ref|XP_001090897.1| PREDICTED: serpin peptidase inhibitor, clade...   149   6e-035
+ref|XP_001091135.1| PREDICTED: serpin peptidase inhibitor, clade...   149   6e-035
+ref|XP_001091267.1| PREDICTED: serine (or cysteine) proteinase i...   149   6e-035
+gb|AAV73919.1| SERPINB3 [Papio papio]                                 148   8e-035
+ref|NP_001030364.1| serine (or cysteine) proteinase inhibitor, c...   148   8e-035
+ref|XP_001254790.1| PREDICTED: similar to SCCA2/SCCA1 fusion pro...   148   1e-034
+ref|XP_001254559.1| PREDICTED: similar to SCCA2/SCCA1 fusion pro...   148   1e-034
+ref|XP_869744.2| PREDICTED: similar to bomapin isoform 2 [Bos ta...   148   1e-034
+ref|XP_001232329.1| PREDICTED: similar to Leukocyte elastase inh...   148   1e-034
+ref|XP_001092672.1| PREDICTED: serpin peptidase inhibitor, clade...   148   1e-034
+ref|XP_001092443.1| PREDICTED: serpin peptidase inhibitor, clade...   148   1e-034
+ref|NP_001006377.1| serine (or cysteine) proteinase inhibitor, c...   148   1e-034
+ref|XP_418980.1| PREDICTED: similar to Leukocyte elastase inhibi...   148   1e-034
+ref|NP_001075416.1| serpin [Equus caballus] >gi|462410|sp|P05619...   148   1e-034
+gb|EAW63158.1| serpin peptidase inhibitor, clade B (ovalbumin), ...   147   1e-034
+gb|AAV73920.1| SERPINB11d [Homo sapiens]                              147   1e-034
+gb|AAQ04770.1|AF461146_1 SCCA2/SCCA1 fusion protein isoform 1 [H...   147   1e-034
+ref|NP_536723.1| serine (or cysteine) proteinase inhibitor, clad...   147   1e-034
+emb|CAD56658.1| squamous cell carcinoma antigen 1 [Homo sapiens]      147   1e-034
+gb|AAP36625.1| Homo sapiens serine (or cysteine) proteinase inhi...   147   1e-034
+gb|AAO11731.1| SCCA-PD variant; squamous cell carcinoma antigen ...   147   1e-034
+gb|AAL16057.1|AF419954_1 serine proteinase inhibitor SERPINB11 [...   147   1e-034
+sp|Q96P15|SPB11_HUMAN Serpin B11 >gi|16226021|gb|AAL16056.1|AF41...   147   1e-034
+ref|NP_008850.1| serine (or cysteine) proteinase inhibitor, clad...   147   1e-034
+gb|AAB20405.1| squamous cell carcinoma antigen; SCC antigen [Hom...   147   1e-034
+ref|XP_001254685.1| PREDICTED: similar to SCCA2/SCCA1 fusion pro...   147   2e-034
+ref|XP_001254006.1| PREDICTED: similar to SCCA2/SCCA1 fusion pro...   147   2e-034
+gb|AAV73921.1| SERPINB11e [Homo sapiens]                              146   4e-034
+ref|NP_033280.1| serine (or cysteine) proteinase inhibitor, clad...   146   4e-034
+ref|XP_001250999.1| PREDICTED: similar to SCCA2/SCCA1 fusion pro...   145   5e-034
+ref|XP_001147517.1| PREDICTED: serine (or cysteine) proteinase i...   145   5e-034
+ref|XP_001147442.1| PREDICTED: serine (or cysteine) proteinase i...   145   5e-034
+ref|XP_001147213.1| PREDICTED: serine (or cysteine) proteinase i...   145   5e-034
+emb|CAI25648.1| serine (or cysteine) proteinase inhibitor, clade...   145   5e-034
+ref|NP_079705.2| serine (or cysteine) proteinase inhibitor, clad...   145   5e-034
+dbj|BAB25964.1| unnamed protein product [Mus musculus]                145   5e-034
+dbj|BAC36206.1| unnamed protein product [Mus musculus]                145   5e-034
+gb|EAW63152.1| serpin peptidase inhibitor, clade B (ovalbumin), ...   145   7e-034
+gb|EAW63151.1| serpin peptidase inhibitor, clade B (ovalbumin), ...   145   7e-034
+gb|AAO92272.1| squamous cell carcinoma antigen 1 [Homo sapiens]       145   7e-034
+gb|AAD55765.1|AF169949_1 headpin [Homo sapiens] >gi|119583557|gb...   145   7e-034
+dbj|BAE32772.1| unnamed protein product [Mus musculus]                145   7e-034
+ref|XP_001091509.1| PREDICTED: similar to serine (or cysteine) p...   145   9e-034
+ref|XP_001091618.1| PREDICTED: similar to serine (or cysteine) p...   145   9e-034
+gb|AAQ04218.1|AF428135_1 SCCA1/SCCA2 fusion protein [Homo sapien...   145   9e-034
+ref|NP_002965.1| serine (or cysteine) proteinase inhibitor, clad...   145   9e-034
+pir||I38202 leupin precursor - human                                  145   9e-034
+dbj|BAB40773.1| SCCA2b [Homo sapiens] >gi|119583558|gb|EAW63154....   145   9e-034
+ref|XP_001090669.1| PREDICTED: serine (or cysteine) proteinase i...   144   1e-033
+gb|AAU14875.1| leukocyte elastase inhibitor [Oncorhynchus mykiss]     144   1e-033
+gb|AAQ04771.1|AF461147_1 SCCA2/SCCA1 fusion protein isoform 2 [H...   144   1e-033
+emb|CAA04937.1| hurpin [Homo sapiens]                                 144   1e-033
+ref|NP_001026812.1| serine (or cysteine) proteinase inhibitor, c...   144   1e-033
+ref|NP_036529.1| serine (or cysteine) proteinase inhibitor, clad...   144   1e-033
+ref|XP_001251041.1| PREDICTED: similar to SCCA2/SCCA1 fusion pro...   144   1e-033
+gb|EAW63160.1| serpin peptidase inhibitor, clade B (ovalbumin), ...   144   1e-033
+pdb|2ARQ|A Chain A, Human Plasminogen Activator Inhibitor-2.[loo...   144   1e-033
+gb|AAX41106.1| serine or cysteine proteinase inhibitor clade B m...   144   1e-033
+gb|AAH12609.1| Serpin peptidase inhibitor, clade B (ovalbumin), ...   144   1e-033
+ref|NP_002566.1| serine (or cysteine) proteinase inhibitor, clad...   144   1e-033
+pdb|1BY7|A Chain A, Human Plasminogen Activator Inhibitor-2. Loo...   144   1e-033
+ref|XP_001141918.1| PREDICTED: serine (or cysteine) proteinase i...   144   2e-033
+ref|XP_001148015.1| PREDICTED: serine (or cysteine) proteinase i...   144   2e-033
+ref|XP_512165.1| PREDICTED: serine (or cysteine) proteinase inhi...   144   2e-033
+ref|XP_512167.2| PREDICTED: serine (or cysteine) proteinase inhi...   143   3e-033
+emb|CAE11879.1| hypothetical protein [Homo sapiens]                   143   3e-033
+ref|NP_942130.1| serine (or cysteine) proteinase inhibitor, clad...   143   3e-033
+ref|XP_001093135.1| PREDICTED: serpin peptidase inhibitor, clade...   143   3e-033
+ref|XP_001091973.1| PREDICTED: serine (or cysteine) proteinase i...   142   4e-033
+ref|XP_001092213.1| PREDICTED: serine (or cysteine) proteinase i...   142   4e-033
+ref|XP_001092087.1| PREDICTED: serine (or cysteine) proteinase i...   142   4e-033
+ref|XP_001092329.1| PREDICTED: serine (or cysteine) proteinase i...   142   4e-033
+ref|XP_857036.1| PREDICTED: similar to Squamous cell carcinoma a...   142   4e-033
+ref|XP_541074.2| PREDICTED: similar to Squamous cell carcinoma a...   142   4e-033
+ref|XP_527219.2| PREDICTED: serine (or cysteine) proteinase inhi...   142   6e-033
+ref|XP_001107117.1| PREDICTED: similar to Serpin B6 (Placental t...   142   6e-033
+gb|AAP36298.1| Homo sapiens serine (or cysteine) proteinase inhi...   142   6e-033
+gb|AAA36413.1| plasminogen activator inhibitor >gi|189563|gb|AAA...   142   6e-033
+dbj|BAD97090.1| serine (or cysteine) proteinase inhibitor, clade...   142   6e-033
+ref|NP_109591.1| serine (or cysteine) proteinase inhibitor, clad...   142   6e-033
+ref|XP_001093348.1| PREDICTED: serpin peptidase inhibitor, clade...   142   7e-033
+ref|XP_001093020.1| PREDICTED: serpin peptidase inhibitor, clade...   142   7e-033
+ref|XP_001091156.1| PREDICTED: serine (or cysteine) proteinase i...   142   7e-033
+dbj|BAE02355.1| unnamed protein product [Macaca fascicularis]         142   7e-033
+ref|XP_573426.1| PREDICTED: similar to serine (or cysteine) prot...   142   7e-033
+ref|NP_714955.2| serine (or cysteine) proteinase inhibitor, clad...   142   7e-033
+ref|XP_001253249.1| PREDICTED: similar to SERPINB12 [Bos taurus]...   141   1e-032
+ref|XP_001091038.1| PREDICTED: similar to serine (or cysteine) p...   141   1e-032
+gb|AAO92271.1| squamous cell carcinoma antigen 2 [Homo sapiens]       140   2e-032
+gb|AAO92273.1| squamous cell carcinoma antigen 2 [Homo sapiens]       140   2e-032
+ref|XP_418985.2| PREDICTED: similar to SERPINB12 protein [Gallus...   140   2e-032
+sp|P50452|SPB8_HUMAN Serpin B8 (Cytoplasmic antiproteinase 2) (C...   140   2e-032
+gb|EAW55099.1| serpin peptidase inhibitor, clade B (ovalbumin), ...   140   3e-032
+gb|EAW55102.1| serpin peptidase inhibitor, clade B (ovalbumin), ...   140   3e-032
+gb|EAW55106.1| serpin peptidase inhibitor, clade B (ovalbumin), ...   140   3e-032
+gb|EAW55101.1| serpin peptidase inhibitor, clade B (ovalbumin), ...   140   3e-032
+gb|EAW55104.1| serpin peptidase inhibitor, clade B (ovalbumin), ...   140   3e-032
+emb|CAD98106.1| hypothetical protein [Homo sapiens]                   140   3e-032
+ref|NP_004559.4| serine (or cysteine) proteinase inhibitor, clad...   140   3e-032
+gb|AAO15303.1|AF116727_1 MSTP057 [Homo sapiens]                       140   3e-032
+ref|XP_541073.2| PREDICTED: similar to serine (or cysteine) prot...   140   3e-032
+sp|Q5R899|SPB6_PONPY Serpin B6 >gi|55730579|emb|CAH92011.1| hypo...   140   3e-032
+sp|P35237|SPB6_HUMAN Serpin B6 (Placental thrombin inhibitor) (C...   140   3e-032
+sp|Q8K3K4|SPB10_RAT Serpin B10 (Transforming growth factor beta ...   140   3e-032
+ref|XP_001365843.1| PREDICTED: similar to plasminogen activator ...   139   4e-032
+emb|CAA80373.1| thrombin inhibitor [Homo sapiens]                     139   4e-032
+ref|XP_851985.1| PREDICTED: similar to Plasminogen activator inh...   139   4e-032
+ref|XP_001148307.1| PREDICTED: similar to Chain A, Human Plasmin...   139   5e-032
+ref|XP_001148522.1| PREDICTED: serine (or cysteine) proteinase i...   139   5e-032
+ref|XP_848373.1| PREDICTED: similar to Placental thrombin inhibi...   139   5e-032
+ref|XP_855911.1| PREDICTED: similar to Placental thrombin inhibi...   139   5e-032
+ref|XP_001376126.1| PREDICTED: similar to bomapin [Monodelphis d...   139   6e-032
+ref|XP_225268.2| PREDICTED: similar to serine (or cysteine) prot...   138   8e-032
+gb|AAH94073.1| MGC115155 protein [Xenopus laevis]                     138   8e-032
+ref|XP_001159818.1| PREDICTED: serine (or cysteine) proteinase i...   138   1e-031
+ref|XP_001160054.1| PREDICTED: serine (or cysteine) proteinase i...   138   1e-031
+ref|NP_954516.1| serine (or cysteine) proteinase inhibitor, clad...   138   1e-031
+ref|NP_956230.1| serpin peptidase inhibitor, clade B (ovalbumin)...   138   1e-031
+ref|NP_777214.1| serine (or cysteine) proteinase inhibitor, clad...   138   1e-031
+emb|CAE45712.1| hypothetical protein [Homo sapiens]                   137   1e-031
+gb|AAP36700.1| Homo sapiens serine (or cysteine) proteinase inhi...   137   1e-031
+ref|NP_004146.1| serine (or cysteine) proteinase inhibitor, clad...   137   1e-031
+ref|XP_222499.4| PREDICTED: similar to serine (or cysteine) prot...   137   2e-031
+ref|XP_989175.1| PREDICTED: similar to serine (or cysteine) prot...   137   2e-031
+ref|XP_989203.1| PREDICTED: similar to serine (or cysteine) prot...   137   2e-031
+ref|NP_033152.2| serine (or cysteine) proteinase inhibitor, clad...   137   2e-031
+gb|AAH50060.1| Serine (or cysteine) peptidase inhibitor, clade B...   137   2e-031
+gb|AAR89287.1| serpinb12 [Mus musculus]                               137   2e-031
+ref|NP_082247.1| serine (or cysteine) proteinase inhibitor, clad...   137   2e-031
+ref|NP_035586.1| serine (or cysteine) proteinase inhibitor, clad...   137   2e-031
+ref|NP_932145.2| serine (or cysteine) proteinase inhibitor, clad...   137   2e-031
+ref|NP_001007733.1| similar to SPI6 [Rattus norvegicus] >gi|5092...   137   2e-031
+sp|Q8K1K6|SPB10_MOUSE Serpin B10 >gi|20988602|gb|AAH29736.1| Ser...   137   2e-031
+gb|AAH74408.1| MGC84405 protein [Xenopus laevis]                      136   4e-031
+ref|XP_418982.1| PREDICTED: similar to plasminogen activator inh...   136   4e-031
+ref|NP_766640.1| serine (or cysteine) proteinase inhibitor, clad...   135   5e-031
+ref|XP_001365539.1| PREDICTED: similar to SERPINB12 isoform 1 [M...   135   7e-031
+ref|XP_001365600.1| PREDICTED: similar to SERPINB12 isoform 2 [M...   135   7e-031
+ref|XP_001365664.1| PREDICTED: similar to SERPINB12 isoform 3 [M...   135   7e-031
+gb|AAC95432.1| squamous cell carcinoma antigen 2 [Mus musculus]       135   7e-031
+gb|AAN62872.1| squamous cell carcinoma antigen 2 related protein...   134   1e-030
+ref|NP_941373.1| serine (or cysteine) proteinase inhibitor, clad...   134   1e-030
+gb|AAR89288.1| serpinb3b [Mus musculus] >gi|68534939|gb|AAH99584...   134   2e-030
+ref|XP_541071.2| PREDICTED: similar to Serpin B10 (Bomapin) (Pro...   134   2e-030
+ref|XP_533382.2| PREDICTED: similar to serine (or cysteine) prot...   134   2e-030
+ref|NP_001011419.1| hypothetical protein LOC496899 [Xenopus trop...   134   2e-030
+ref|NP_001012214.1| serine (or cysteine) proteinase inhibitor, c...   134   2e-030
+emb|CAF98097.1| unnamed protein product [Tetraodon nigroviridis]      134   2e-030
+ref|XP_001376191.1| PREDICTED: similar to Leukocyte elastase inh...   134   2e-030
+dbj|BAD92800.1| Hypothetical protein DKFZp686I04222 variant [Hom...   134   2e-030
+ref|XP_582291.2| PREDICTED: similar to plasminogen activator inh...   134   2e-030
+ref|NP_899020.1| serine (or cysteine) proteinase inhibitor, clad...   133   3e-030
+emb|CAF98095.1| unnamed protein product [Tetraodon nigroviridis]      132   5e-030
+ref|XP_001160007.1| PREDICTED: serine (or cysteine) proteinase i...   132   6e-030
+emb|CAI25478.1| serine protease inhibitor 12 [Mus musculus]           132   6e-030
+ref|NP_001002653.1| serpin peptidase inhibitor, clade B (ovalbum...   132   6e-030
+ref|NP_035584.1| serine (or cysteine) proteinase inhibitor, clad...   132   6e-030
+gb|AAL65909.1|AF425083_1 NK21B [Mus musculus] >gi|40352847|gb|AA...   132   6e-030
+ref|XP_619089.1| PREDICTED: similar to serine (or cysteine) prot...   132   6e-030
+ref|NP_001008887.1| serine protease inhibitor B3 [Rattus norvegi...   132   6e-030
+ref|XP_001147068.1| PREDICTED: serine (or cysteine) proteinase i...   132   8e-030
+ref|XP_523956.2| PREDICTED: serine (or cysteine) proteinase inhi...   132   8e-030
+gb|AAI03885.1| SERPINB12 protein [Homo sapiens]                       132   8e-030
+gb|AAI03886.1| SERPINB12 protein [Homo sapiens]                       132   8e-030
+dbj|BAE42644.1| unnamed protein product [Mus musculus]                132   8e-030
+ref|NP_536722.1| serine (or cysteine) proteinase inhibitor, clad...   132   8e-030
+ref|XP_001090435.1| PREDICTED: similar to serine (or cysteine) p...   131   1e-029
+ref|XP_001090546.1| PREDICTED: similar to serine (or cysteine) p...   131   1e-029
+gb|AAH54232.1| MGC64421 protein [Xenopus laevis]                      131   1e-029
+ref|NP_001069327.1| hypothetical protein LOC524513 [Bos taurus] ...   131   1e-029
+tpe|CAE51415.1| TPA: serine proteinase inhibitor B3-like 1 precu...   131   1e-029
+ref|XP_001365469.1| PREDICTED: similar to gag-protease [Monodelp...   131   1e-029
+gb|AAH81162.1| MGC84275 protein [Xenopus laevis]                      131   1e-029
+gb|AAI17992.1| Serpinb13 protein [Mus musculus]                       130   2e-029
+gb|AAI17991.1| Serine (or cysteine) peptidase inhibitor, clade B...   130   2e-029
+ref|XP_001254828.1| PREDICTED: similar to SERPINB3 [Bos taurus]       130   2e-029
+ref|NP_958764.1| serine (or cysteine) proteinase inhibitor, clad...   130   2e-029
+ref|NP_001007932.1| serpinb8 protein [Xenopus tropicalis] >gi|51...   130   2e-029
+ref|NP_001011282.1| serine (or cysteine) proteinase inhibitor, c...   130   3e-029
+ref|XP_871118.2| PREDICTED: similar to thrombin inhibitor [Bos t...   129   4e-029
+ref|NP_035585.1| serine (or cysteine) proteinase inhibitor, clad...   129   4e-029
+ref|NP_033282.1| serine (or cysteine) proteinase inhibitor, clad...   129   5e-029
+ref|XP_581432.2| PREDICTED: similar to plasminogen activator inh...   129   5e-029
+ref|NP_476449.1| serine (or cysteine) proteinase inhibitor, clad...   129   5e-029
+gb|AAI32092.1| Serpinb3c protein [Mus musculus]                       129   6e-029
+ref|NP_958751.1| serine (or cysteine) proteinase inhibitor, clad...   129   6e-029
+gb|AAB57813.1| serine proteinase inhibitor mBM2A [Mus musculus]       129   6e-029
+gb|AAH10313.1| Serine (or cysteine) peptidase inhibitor, clade B...   129   6e-029
+ref|NP_080143.1| serine (or cysteine) proteinase inhibitor, clad...   129   6e-029
+ref|NP_035590.1| serine (or cysteine) proteinase inhibitor, clad...   128   8e-029
+gb|AAB57814.1| serine proteinase inhibitor mBM17 [Mus musculus]       128   8e-029
+ref|NP_766440.1| serine (or cysteine) proteinase inhibitor, clad...   128   8e-029
+ref|XP_222497.2| PREDICTED: similar to serine (or cysteine) prot...   128   1e-028
+emb|CAA04047.1| serpin [Mus musculus]                                 128   1e-028
+ref|NP_001038636.1| hypothetical protein LOC568898 [Danio rerio]...   127   1e-028
+ref|XP_541075.2| PREDICTED: similar to Serpin B13 (Hurpin) (HaCa...   127   1e-028
+ref|XP_225267.4| PREDICTED: similar to serine (or cysteine) prot...   127   2e-028
+ref|XP_001066335.1| PREDICTED: similar to serine (or cysteine) p...   127   2e-028
+ref|NP_033283.1| serine (or cysteine) proteinase inhibitor, clad...   127   2e-028
+ref|XP_001365727.1| PREDICTED: similar to SCCA2/SCCA1 fusion pro...   126   3e-028
+dbj|BAB22916.1| unnamed protein product [Mus musculus]                126   3e-028
+ref|XP_541072.2| PREDICTED: similar to Serpin B7 (Megsin) (TP55)...   126   3e-028
+ref|NP_035241.1| serine (or cysteine) proteinase inhibitor, clad...   126   3e-028
+ref|NP_067728.1| serine (or cysteine) proteinase inhibitor, clad...   126   3e-028
+ref|XP_001250799.1| PREDICTED: similar to thrombin inhibitor iso...   125   6e-028
+ref|XP_874750.2| PREDICTED: similar to thrombin inhibitor isofor...   125   6e-028
+ref|XP_001250752.1| PREDICTED: similar to thrombin inhibitor iso...   125   6e-028
+pdb|2DUT|A Chain A, Crystal Structure Of A M-Loop Deletion Varia...   125   6e-028
+pdb|2H4R|A Chain A, Crystal Structure Of Wildtype Ment In The Na...   125   6e-028
+gb|AAH64768.1| Serine (or cysteine) peptidase inhibitor, clade B...   125   6e-028
+ref|XP_591267.2| PREDICTED: similar to TP55 [Bos taurus]              125   6e-028
+ref|NP_990228.1| heterochromatin-associated protein MENT [Gallus...   125   6e-028
+ref|XP_001160090.1| PREDICTED: serpin peptidase inhibitor, clade...   125   7e-028
+gb|AAH27859.2| SERPINI2 protein [Homo sapiens]                        125   7e-028
+gb|AAX36869.1| serine or cysteine proteinase inhibitor clade I m...   125   7e-028
+gb|AAX36420.1| serine or cysteine proteinase inhibitor clade I m...   125   7e-028
+ref|XP_516858.1| PREDICTED: serpin peptidase inhibitor, clade I ...   125   7e-028
+dbj|BAE39626.1| unnamed protein product [Mus musculus]                125   7e-028
+ref|NP_006208.1| serpin peptidase inhibitor, clade I (pancpin), ...   125   7e-028
+ref|NP_035582.1| serine (or cysteine) proteinase inhibitor, clad...   125   7e-028
+ref|XP_001376155.1| PREDICTED: similar to serpin peptidase inhib...   125   9e-028
+ref|XP_001064414.1| PREDICTED: similar to serine (or cysteine) p...   125   9e-028
+ref|XP_001087507.1| PREDICTED: serpin peptidase inhibitor, clade...   125   9e-028
+ref|XP_222495.3| PREDICTED: similar to serine (or cysteine) prot...   125   9e-028
+ref|XP_001365903.1| PREDICTED: similar to serpin peptidase inhib...   124   1e-027
+ref|XP_614054.3| PREDICTED: similar to maspin [Bos taurus]            124   1e-027
+gb|AAV73923.1| SERPINB11g [Homo sapiens]                              124   1e-027
+ref|NP_003775.1| serine (or cysteine) proteinase inhibitor, clad...   124   1e-027
+pdb|1WZ9|A Chain A, The 2.1 A Structure Of A Tumour Suppressing ...   124   2e-027
+ref|NP_683744.2| serine proteinase inhibitor member 6C [Mus musc...   124   2e-027
+gb|AAH62169.1| Serpinb6c protein [Mus musculus] >gi|56205918|emb...   124   2e-027
+gb|AAL65910.1|AF425084_1 SPI3C [Mus musculus]                         124   2e-027
+gb|EAW63147.1| serpin peptidase inhibitor, clade B (ovalbumin), ...   123   3e-027
+gb|EAW63146.1| serpin peptidase inhibitor, clade B (ovalbumin), ...   123   3e-027
+ref|XP_001091734.1| PREDICTED: serine (or cysteine) proteinase i...   123   3e-027
+gb|AAX36424.1| serine or cysteine proteinase inhibitor clade B m...   123   3e-027
+gb|AAH82925.1| LOC494797 protein [Xenopus laevis]                     123   3e-027
+pdb|1XU8|A Chain A, The 2.8 A Structure Of A Tumour Suppressing ...   123   3e-027
+ref|NP_002630.1| serine (or cysteine) proteinase inhibitor, clad...   123   3e-027
+ref|XP_523955.2| PREDICTED: similar to Chain A, The 2.8 A Struct...   123   4e-027
+ref|XP_001146935.1| PREDICTED: serine (or cysteine) proteinase i...   123   4e-027
+ref|XP_001080188.1| PREDICTED: similar to serine (or cysteine) p...   122   5e-027
+ref|XP_225265.4| PREDICTED: similar to serine (or cysteine) prot...   122   5e-027
+pdb|1XQG|A Chain A, 3.10 A Crystal Structure Of Maspin, Space Gr...   122   5e-027
+ref|NP_998042.1| serpin peptidase inhibitor, clade B (ovalbumin)...   122   6e-027
+ref|NP_001070258.1| hypothetical protein LOC238568 [Mus musculus...   122   6e-027
+ref|XP_516861.2| PREDICTED: serine (or cysteine) proteinase inhi...   122   8e-027
+ref|XP_001092558.1| PREDICTED: serpin peptidase inhibitor, clade...   122   8e-027
+ref|XP_001090087.1| PREDICTED: similar to serine (or cysteine) p...   122   8e-027
+gb|AAF70387.1|AF193015_1 neuroserpin [Rattus norvegicus]              122   8e-027
+ref|NP_001039000.1| hypothetical protein LOC435350 [Mus musculus...   122   8e-027
+ref|NP_446231.1| serine (or cysteine) peptidase inhibitor, clade...   122   8e-027
+ref|NP_005016.1| serine (or cysteine) proteinase inhibitor, clad...   121   1e-026
+ref|XP_225266.3| PREDICTED: similar to serine (or cysteine) prot...   121   1e-026
+emb|CAI25077.1| novel serine (or cysteine) proteinase inhibitor,...   121   1e-026
+ref|XP_001376051.1| PREDICTED: similar to TP55 [Monodelphis dome...   120   3e-026
+ref|XP_535853.2| PREDICTED: similar to Neuroserpin precursor (Se...   120   3e-026
+gb|AAH74366.1| MGC84260 protein [Xenopus laevis]                      119   4e-026
+ref|XP_597433.3| PREDICTED: similar to SERPINI2 protein [Bos tau...   119   5e-026
+dbj|BAE90150.1| unnamed protein product [Macaca fascicularis]         119   5e-026
+ref|XP_001094643.1| PREDICTED: serine (or cysteine) proteinase i...   119   5e-026
+emb|CAI25617.1| serine protease inhibitor 11 [Mus musculus]           119   5e-026
+gb|AAH51664.1| Serpinb9c protein [Mus musculus]                       119   5e-026
+ref|NP_035583.1| serine (or cysteine) proteinase inhibitor, clad...   119   5e-026
+ref|XP_855707.1| PREDICTED: similar to Cytoplasmic antiproteinas...   119   5e-026
+ref|XP_855679.1| PREDICTED: similar to Cytoplasmic antiproteinas...   119   5e-026
+ref|XP_545314.2| PREDICTED: similar to Cytoplasmic antiproteinas...   119   5e-026
+ref|XP_855831.1| PREDICTED: similar to Cytoplasmic antiproteinas...   119   5e-026
+ref|XP_855782.1| PREDICTED: similar to Cytoplasmic antiproteinas...   119   5e-026
+gb|AAH18043.1| SERPINI1 protein [Homo sapiens]                        119   5e-026
+gb|AAI29615.1| Unknown (protein for MGC:160290) [Xenopus laevis]      118   9e-026
+dbj|BAF36966.1| serine protease inhibitor 9 [Sus scrofa]              118   9e-026
+ref|XP_001092905.1| PREDICTED: serpin peptidase inhibitor, clade...   118   9e-026
+ref|NP_766639.1| serine (or cysteine) proteinase inhibitor, clad...   118   9e-026
+ref|XP_587050.1| PREDICTED: similar to neuroserpin [Bos taurus]       118   9e-026
+emb|CAJ19239.1| neuroserpin precursor [Xenopus laevis]                118   9e-026
+ref|XP_001147740.1| PREDICTED: serine (or cysteine) proteinase i...   118   1e-025
+ref|XP_001249947.1| PREDICTED: similar to thrombin inhibitor [Bo...   117   1e-025
+ref|XP_001147364.1| PREDICTED: similar to hurpin isoform 2 [Pan ...   117   1e-025
+ref|XP_001091016.1| PREDICTED: serpin peptidase inhibitor, clade...   117   1e-025
+gb|EAW63150.1| serpin peptidase inhibitor, clade B (ovalbumin), ...   117   2e-025
+gb|EAW63157.1| serpin peptidase inhibitor, clade B (ovalbumin), ...   117   3e-025
+dbj|BAB40772.1| SCCA1b [Homo sapiens]                                 117   3e-025
+ref|XP_001141841.1| PREDICTED: similar to SCCA2b [Pan troglodytes]    116   3e-025
+ref|XP_851407.1| PREDICTED: similar to serine/cysteine proteinas...   116   3e-025
+ref|NP_569088.1| serine (or cysteine) proteinase inhibitor, clad...   116   3e-025
+emb|CAC03569.1| hurpin [Homo sapiens]                                 116   3e-025
+emb|CAJ55430.1| serpin 2 precursor [Branchiostoma lanceolatum]        116   4e-025
+ref|XP_418986.2| PREDICTED: similar to maspin [Gallus gallus]         116   4e-025
+ref|NP_081824.1| serine (or cysteine) proteinase inhibitor, clad...   116   4e-025
+ref|XP_856995.1| PREDICTED: similar to Squamous cell carcinoma a...   115   7e-025
+dbj|BAB23335.1| unnamed protein product [Mus musculus]                115   7e-025
+emb|CAA83060.1| ZG-21p [Rattus norvegicus]                            115   1e-024
+ref|XP_342264.1| PREDICTED: similar to Serpin I2 precursor (Seri...   115   1e-024
+emb|CAD68157.1| serine protease inhibitor [Branchiostoma lanceol...   115   1e-024
+ref|XP_874742.2| PREDICTED: similar to thrombin inhibitor [Bos t...   114   1e-024
+gb|AAH06776.1| Serine (or cysteine) peptidase inhibitor, clade I...   114   1e-024
+ref|NP_033276.1| serine (or cysteine) proteinase inhibitor, clad...   114   1e-024
+ref|XP_001147947.1| PREDICTED: serine (or cysteine) proteinase i...   114   2e-024
+gb|AAH64004.1| Serine (or cysteine) peptidase inhibitor, clade B...   114   2e-024
+ref|NP_001004411.1| serine (or cysteine) proteinase inhibitor, c...   114   2e-024
+gb|AAT35220.1| serine protease inhibitor jellypin [Cyanea capill...   114   2e-024
+emb|CAI64376.1| serpin 1 precursor [Branchiostoma lanceolatum]        114   2e-024
+emb|CAI64375.1| serpin 6 precursor [Branchiostoma lanceolatum]        114   2e-024
+dbj|BAC56339.1| similar to thrombin inhibitor [Bos taurus]            114   2e-024
+ref|XP_876941.2| PREDICTED: similar to hurpin isoform 4, partial...   113   4e-024
+ref|XP_001254602.1| PREDICTED: similar to hurpin [Bos taurus]         113   4e-024
+ref|XP_797023.1| PREDICTED: similar to serpin 1 precursor [Stron...   112   5e-024
+ref|XP_001160849.1| PREDICTED: serine (or cysteine) proteinase i...   112   6e-024
+ref|XP_001367598.1| PREDICTED: similar to TSA2004 [Monodelphis d...   112   8e-024
+ref|ZP_01687664.1| scca2/scca1 fusion protein isoform 1 [Microsc...   112   8e-024
+emb|CAJ38562.1| serpin 2 precursor [Branchiostoma lanceolatum]        112   8e-024
+ref|YP_001046375.1| proteinase inhibitor I4, serpin [Methanocull...   112   8e-024
+ref|XP_787959.1| PREDICTED: similar to serine protease inhibitor...   111   1e-023
+pdb|1HLE|A Chain A, Horse Leukocyte Elastase Inhibitor (Hlei)         111   1e-023
+ref|XP_001096714.1| PREDICTED: similar to Serpin B6 (Placental t...   111   1e-023
+ref|XP_001376139.1| PREDICTED: similar to thrombin inhibitor [Mo...   110   2e-023
+ref|NP_080736.2| serine (or cysteine) peptidase inhibitor, clade...   110   2e-023
+dbj|BAB25079.1| unnamed protein product [Mus musculus]                110   2e-023
+emb|CAB64714.1| antithrombin [Salmo salar]                            110   2e-023
+dbj|BAB24976.1| unnamed protein product [Mus musculus]                110   2e-023
+ref|XP_001203210.1| PREDICTED: similar to leukocyte elastase inh...   109   5e-023
+pdb|2GD4|I Chain I, Crystal Structure Of The Antithrombin-S195a ...   109   5e-023
+ref|XP_001362816.1| PREDICTED: similar to neuroserpin [Monodelph...   108   9e-023
+ref|ZP_00530649.1| Proteinase inhibitor I4, serpin [Chlorobium p...   108   9e-023
+gb|ABF57399.1| serine (or cysteine) proteinase inhibitor, clade ...   108   1e-022
+ref|XP_785336.1| PREDICTED: similar to serpin 6 precursor [Stron...   108   1e-022
+ref|XP_001151458.1| PREDICTED: serine (or cysteine) proteinase i...   107   2e-022
+ref|XP_001151521.1| PREDICTED: serine (or cysteine) proteinase i...   107   2e-022
+ref|XP_514008.2| PREDICTED: serine (or cysteine) proteinase inhi...   107   2e-022
+ref|XP_787985.1| PREDICTED: similar to serpin 6 precursor [Stron...   107   2e-022
+pdb|1DZG|I Chain I, N135q-S380c-Antithrombin-Iii                      107   2e-022
+pdb|1DZH|I Chain I, P14-Fluorescein-N135q-S380c-Antithrombin-Iii      107   2e-022
+pdb|2B4X|L Chain L, Crystal Structure Of Antithrombin-Iii             107   2e-022
+pdb|2B4X|I Chain I, Crystal Structure Of Antithrombin-Iii             107   2e-022
+sp|Q5R5A3|ANT3_PONPY Antithrombin-III precursor (ATIII) >gi|5573...   107   2e-022
+ref|NP_000479.1| serine (or cysteine) proteinase inhibitor, clad...   107   2e-022
+pdb|1ATH|A Chain A, Antithrombin Iii >gi|1000039|pdb|1ANT|L Chai...   107   2e-022
+pdb|1ATH|B Chain B, Antithrombin Iii                                  107   2e-022
+dbj|BAA06212.1| antithrombin III variant [Homo sapiens]               106   3e-022
+ref|XP_001056979.1| PREDICTED: similar to serine (or cysteine) p...   106   5e-022
+ref|NP_878283.1| serine (or cysteine) proteinase inhibitor, clad...   106   5e-022
+pdb|1TB6|I Chain I, 2.5a Crystal Structure Of The Antithrombin-T...   106   5e-022
+dbj|BAA77461.1| antithrombin III [Takifugu rubripes]                  105   6e-022
+gb|ABK54295.1| antithrombin III [Macaca mulatta]                      105   8e-022
+ref|XP_790071.1| PREDICTED: similar to serpin 6 precursor [Stron...   105   8e-022
+ref|XP_790112.1| PREDICTED: similar to serpin 6 precursor [Stron...   105   8e-022
+ref|ZP_00511389.1| Proteinase inhibitor I4, serpin [Chlorobium l...   105   8e-022
+pdb|1OYH|I Chain I, Crystal Structure Of P13 Alanine Variant Of ...   105   1e-021
+emb|CAJ38563.1| serpin 7 precursor [Branchiostoma lanceolatum]        104   1e-021
+ref|NP_938400.1| 149R [Yaba monkey tumor virus] >gi|38000578|gb|...   103   2e-021
+gb|AAL60465.1|AF411691_1 antithrombin [Struthio camelus]              103   2e-021
+gb|AAA51796.1| antithrombin III                                       103   3e-021
+ref|NP_570581.1| putative serpin I-2 protein; CMLV191 [Camelpox ...   103   4e-021
+gb|AAG37694.1| CMP188R [Camelpox virus CMS]                           103   4e-021
+ref|XP_001373404.1| PREDICTED: similar to antithrombin III [Mono...   102   5e-021
+ref|XP_790133.1| PREDICTED: similar to serpin 6 precursor [Stron...   102   5e-021
+ref|XP_685811.2| PREDICTED: similar to MGC84260 protein [Danio r...   102   7e-021
+ref|XP_001198262.1| PREDICTED: similar to serpin 6 precursor [St...   102   7e-021
+gb|AAL60466.1|AF411692_1 antithrombin [Chelydra serpentina]           102   7e-021
+emb|CAD90738.1| B12R protein [Cowpox virus]                           102   9e-021
+gb|AAL73207.1|AF335570_1 antithrombin III [Sphenodon punctatus]       101   1e-020
+gb|AAB61755.1| antithrombin III [Cyprinus carpio] >gi|2245652|gb...   101   1e-020
+ref|XP_600763.2| PREDICTED: similar to Ovalbumin-related protein...   101   1e-020
+gb|ABC54557.1| protease nexin-1 [Xenopus laevis]                      101   1e-020
+emb|CAJ81471.1| serine (or cysteine) proteinase inhibitor, clade...   101   1e-020
+ref|XP_001375826.1| PREDICTED: hypothetical protein [Monodelphis...   100   2e-020
+ref|XP_001203917.1| PREDICTED: similar to serpin 6 precursor, pa...   100   2e-020
+ref|YP_717508.1| SPI-2/CrmA IL-1 convertase [Taterapox virus] >g...   100   2e-020
+ref|NP_671680.1| serpin C7R [Ectromelia virus] >gi|4090821|gb|AA...   100   2e-020
+gb|AAF30285.1|AF219903_1 serine protease inhibitor [Ectromelia v...   100   2e-020
+ref|NP_001012027.1| serine (or cysteine) peptidase inhibitor, cl...   100   2e-020
+ref|ZP_01687665.1| scca2/scca1 fusion protein isoform 1 [Microsc...   100   2e-020
+gb|AAV80788.1| putative secreted salivary gland peptide [Ixodes ...   100   2e-020
+gb|AAH77742.1| Serpine2-prov protein [Xenopus laevis]                 100   2e-020
+ref|NP_001008153.1| MGC89905 protein [Xenopus tropicalis] >gi|51...   100   2e-020
+ref|NP_617161.1| squamous cell carcinoma antigen [Methanosarcina...   100   2e-020
+emb|CAF90488.1| unnamed protein product [Tetraodon nigroviridis]      100   2e-020
+dbj|BAA77781.1| antithrombin III [Cavia porcellus]                    100   2e-020
+ref|NP_073534.1| 149R protein [Yaba-like disease virus] >gi|1205...   100   2e-020
+ref|XP_001203203.1| PREDICTED: similar to serpin 6 precursor [St...   100   3e-020
+gb|AAL60467.1|AF411693_1 antithrombin [Xenopus laevis] >gi|27370...   100   3e-020
+ref|NP_543120.1| serine (or cysteine) proteinase inhibitor, clad...   100   3e-020
+gb|ABF24348.1| SPI-2/CrmA, IL-1 convertase [Variola virus] >gi|9...   100   4e-020
+ref|YP_001047143.1| proteinase inhibitor I4, serpin [Methanocull...   100   4e-020
+gb|ABF82362.1| antithrombin protein [Sus scrofa]                      100   4e-020
+gb|AAA69393.1| D2R [Variola virus] >gi|1150670|emb|CAA50963.1| u...   100   4e-020
+gb|ABF25960.1| SPI-2/CrmA, IL-1 convertase [Variola virus]             99   6e-020
+gb|ABF25759.1| SPI-2/CrmA, IL-1 convertase [Variola virus]             99   6e-020
+gb|ABF24549.1| SPI-2/CrmA, IL-1 convertase [Variola virus] >gi|9...    99   6e-020
+gb|ABF22946.1| SPI-2/CrmA, IL-1 convertase [Variola virus] >gi|9...    99   6e-020
+gb|AAU01375.1| MPXV-WRAIR165 [Monkeypox virus] >gi|58220635|gb|A...    99   6e-020
+emb|CAB69785.1| putative serine protease inhibitor [Anopheles ga...    99   6e-020
+gb|AAY97379.1| bifunctional SPI-2/CrmA protein/IL-1 convertase [...    99   6e-020
+ref|NP_042225.1| hypothetical protein VARVgp181 [Variola virus] ...    99   6e-020
+ref|XP_898988.1| PREDICTED: hypothetical protein LOC319433 [Mus ...    99   7e-020
+ref|YP_565417.1| proteinase inhibitor I4, serpin [Methanococcoid...    99   9e-020
+ref|YP_227542.1| Serpin-like protein [Mule deer poxvirus] >gi|11...    99   9e-020
+ref|XP_917531.1| PREDICTED: similar to serine (or cysteine) prot...    99   9e-020
+ref|NP_001015754.1| MGC107953 protein [Xenopus tropicalis] >gi|5...    99   9e-020
+ref|XP_314156.2| ENSANGP00000022846 [Anopheles gambiae str. PEST...    99   9e-020
+gb|ABI94058.1| serpin-8 precursor [Ixodes ricinus]                     98   1e-019
+gb|ABG43754.1| SPI-2/CrmA IL-1 convertase [Variola virus]              98   1e-019
+ref|XP_001073783.1| PREDICTED: similar to serine (or cysteine) p...    98   1e-019
+emb|CAE46069.1| hypothetical protein [Homo sapiens]                    98   1e-019
+emb|CAE45703.1| hypothetical protein [Homo sapiens]                    98   1e-019
+dbj|BAA03374.1| intracellular coagulation inhibitor precursor [T...    98   1e-019
+gb|AAB35653.1| antithrombin; AT-III [Gallus gallus]                    98   2e-019
+dbj|BAC56533.1| similar to thrombin inhibitor [Bos taurus]             98   2e-019
+gb|ABI94057.1| serpin-4 precursor [Ixodes ricinus]                     97   2e-019
+ref|YP_184195.1| serine protease inhibitor Serpin homolog [Therm...    97   3e-019
+sp|P42926|SPI2_RABPU Serine proteinase inhibitor 2 (Serpin-2) (S...    97   3e-019
+gb|ABI94055.1| serpin-1 precursor [Ixodes ricinus]                     97   4e-019
+ref|XP_001235490.1| PREDICTED: similar to alpha-1-antitrypsin [G...    96   5e-019
+pdb|2H4P|A Chain A, Crystal Structure Of Wildtype Ment In The Cl...    96   5e-019
+ref|NP_536600.1| B12R [Monkeypox virus] >gi|17529953|gb|AAL40631...    96   5e-019
+dbj|BAE35289.1| unnamed protein product [Mus musculus]                 96   5e-019
+ref|NP_033281.1| serine (or cysteine) proteinase inhibitor, clad...    96   5e-019
+gb|AAH10675.1| Serine (or cysteine) peptidase inhibitor, clade E...    96   5e-019
+ref|NP_990622.1| serine (or cysteine) proteinase inhibitor, clad...    96   5e-019
+ref|NP_634699.1| Serine protease inhibitor [Methanosarcina mazei...    96   5e-019
+gb|EAX08872.1| hCG2020343, isoform CRA_c [Homo sapiens]                96   6e-019
+ref|XP_509786.2| PREDICTED: hypothetical protein [Pan troglodytes]     96   6e-019
+ref|XP_935296.2| PREDICTED: similar to serine (or cysteine) prot...    96   6e-019
+sp|P50449|PAI1_MUSVI Plasminogen activator inhibitor 1 precursor...    96   6e-019
+pdb|1ATT|B Chain B, Antithrombin Iii (Atiii) (Synchrotron Radiat...    96   6e-019
+gb|EAX08870.1| hCG2020343, isoform CRA_a [Homo sapiens]                95   1e-018
+gb|EAX08871.1| hCG2020343, isoform CRA_b [Homo sapiens]                95   1e-018
+gb|AAI23835.1| Serpin peptidase inhibitor, clade E (nexin, plasm...    95   1e-018
+gb|AAF25881.1|AF210380_1 nexin [Bos taurus]                            95   1e-018
+gb|AAB42377.1| BmSERPIN [Brugia malayi]                                95   1e-018
+ref|XP_851657.1| PREDICTED: similar to Glia derived nexin precur...    95   1e-018
+ref|XP_682911.1| PREDICTED: similar to HSP47 [Danio rerio]             95   1e-018
+ref|NP_777094.1| plasminogen activator inhibitor type 1, member ...    95   1e-018
+ref|XP_001346447.1| PREDICTED: similar to serine proteinase inhi...    95   1e-018
+pdb|2H4Q|A Chain A, Crystal Structure Of A M-Loop Deletion Varia...    95   1e-018
+ref|XP_974388.1| PREDICTED: similar to Squamous cell carcinoma a...    95   1e-018
+gb|AAY55335.1| IP11254p [Drosophila melanogaster]                      95   1e-018
+gb|AAY54664.1| IP11454p [Drosophila melanogaster] >gi|66770809|g...    95   1e-018
+ref|XP_395991.2| PREDICTED: similar to Serine protease inhibitor...    95   1e-018
+gb|AAW23642.1| serine protease inhibitor [Vaccinia virus] >gi|56...    95   1e-018
+ref|NP_609128.1| Serine protease inhibitor 7 CG6717-PA [Drosophi...    95   1e-018
+ref|NP_618277.1| serine protease inhibitor [Methanosarcina aceti...    95   1e-018
+ref|NP_619988.1| CrmA or CPXV207 protein [Cowpox virus] >gi|1231...    95   1e-018
+ref|XP_001060394.1| PREDICTED: similar to Glia-derived nexin pre...    94   2e-018
+
+>sp|P01013|OVALX_CHICK Ovalbumin-related protein X (Gene X protein)
+          Length = 232
+
+ Score =  324 bits (830), Expect = 1e-087
+ Identities = 162/162 (100%), Positives = 162/162 (100%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM
+Sbjct: 71  KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 130
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGST 120
+           KIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGST
+Sbjct: 131 KIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGST 190
+
+Query: 121 GVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           GVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP
+Sbjct: 191 GVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 232
+
+
+>ref|XP_418984.2| PREDICTED: similar to Ovalbumin-related protein Y (Gene Y protein)
+           [Gallus gallus]
+          Length = 388
+
+ Score =  319 bits (817), Expect = 3e-086
+ Identities = 160/162 (98%), Positives = 160/162 (98%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           KMKILELPFASGDLSMLVLLPDEVS LERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM
+Sbjct: 227 KMKILELPFASGDLSMLVLLPDEVSGLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 286
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGST 120
+           KIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGST
+Sbjct: 287 KIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGST 346
+
+Query: 121 GVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           GVIEDIKHSPE EQFRADHPFLFLIKHNPTNTIVYFGRYWSP
+Sbjct: 347 GVIEDIKHSPELEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 388
+
+
+>emb|CAA23685.1| unnamed protein product [Gallus gallus]
+          Length = 133
+
+ Score =  270 bits (690), Expect = 2e-071
+ Identities = 133/133 (100%), Positives = 133/133 (100%)
+
+Query: 30  IEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTSVLMALGMTDLFIPSANLTG 89
+           IEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTSVLMALGMTDLFIPSANLTG
+Sbjct: 1   IEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTSVLMALGMTDLFIPSANLTG 60
+
+Query: 90  ISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNP 149
+           ISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNP
+Sbjct: 61  ISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNP 120
+
+Query: 150 TNTIVYFGRYWSP 162
+           TNTIVYFGRYWSP
+Sbjct: 121 TNTIVYFGRYWSP 133
+
+
+>ref|NP_001026172.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 3 [Gallus gallus]
+ sp|P01014|OVALY_CHICK Ovalbumin-related protein Y (Gene Y protein)
+ gb|AAA68882.1| ovalbumin [Gallus gallus]
+          Length = 388
+
+ Score =  253 bits (645), Expect = 3e-066
+ Identities = 123/162 (75%), Positives = 141/162 (87%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           KMKILELP+ASGDLSMLVLLPDEVS LERIEKTINF+KL EWT+ N M K+ +KVYLP+M
+Sbjct: 227 KMKILELPYASGDLSMLVLLPDEVSGLERIEKTINFDKLREWTSTNAMAKKSMKVYLPRM 286
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGST 120
+           KIEEKYNLTS+LMALGMTDLF  SANLTGISS ++L IS AVHG FME++E+G E  GST
+Sbjct: 287 KIEEKYNLTSILMALGMTDLFSRSANLTGISSVDNLMISDAVHGVFMEVNEEGTEATGST 346
+
+Query: 121 GVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           G I +IKHS E E+FRADHPFLF I++NPTN I++FGRYWSP
+Sbjct: 347 GAIGNIKHSLELEEFRADHPFLFFIRYNPTNAILFFGRYWSP 388
+
+
+>pdb|1JTI|A Chain A, Loop-Inserted Structure Of P1-P1' Cleaved Ovalbumin Mutant
+           R339t
+ pdb|1JTI|B Chain B, Loop-Inserted Structure Of P1-P1' Cleaved Ovalbumin Mutant
+           R339t
+          Length = 385
+
+ Score =  216 bits (550), Expect = 3e-055
+ Identities = 110/162 (67%), Positives = 132/162 (81%), Gaps = 2/162 (1%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           KMKILELPFASG +SMLVLLPDEVS LE++E  INFEKLTEWT+ N ME+R++KVYLP+M
+Sbjct: 226 KMKILELPFASGTMSMLVLLPDEVSGLEQLESIINFEKLTEWTSSNVMEERKIKVYLPRM 285
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGST 120
+           K+EEKYNLTSVLMA+G+TD+F  SANL+GISSAESLKISQAVH A  E++E G E+ GS
+Sbjct: 286 KMEEKYNLTSVLMAMGITDVFSSSANLSGISSAESLKISQAVHAAHAEINEAGTEVVGSA 345
+
+Query: 121 GVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+                +  +  SE+FRADHPFLF IKH  TN +++FGR  SP
+Sbjct: 346 EA--GVDAASVSEEFRADHPFLFCIKHIATNAVLFFGRCVSP 385
+
+
+>sp|P01012|OVAL_CHICK Ovalbumin (Egg albumin) (Plakalbumin) (Allergen Gal d 2) (Gal d II)
+ gb|AAA48998.1| ovalbumin
+ gb|AAB59956.1| ovalbumin [Gallus gallus]
+ emb|CAA23716.1| ovalbumin [Gallus gallus]
+          Length = 386
+
+ Score =  215 bits (548), Expect = 5e-055
+ Identities = 110/162 (67%), Positives = 132/162 (81%), Gaps = 2/162 (1%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           KMKILELPFASG +SMLVLLPDEVS LE++E  INFEKLTEWT+ N ME+R++KVYLP+M
+Sbjct: 227 KMKILELPFASGTMSMLVLLPDEVSGLEQLESIINFEKLTEWTSSNVMEERKIKVYLPRM 286
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGST 120
+           K+EEKYNLTSVLMA+G+TD+F  SANL+GISSAESLKISQAVH A  E++E G E+ GS
+Sbjct: 287 KMEEKYNLTSVLMAMGITDVFSSSANLSGISSAESLKISQAVHAAHAEINEAGREVVGSA 346
+
+Query: 121 GVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+                +  +  SE+FRADHPFLF IKH  TN +++FGR  SP
+Sbjct: 347 EA--GVDAASVSEEFRADHPFLFCIKHIATNAVLFFGRCVSP 386
+
+
+>ref|NP_990483.1| ovalbumin [Gallus gallus]
+ emb|CAA23682.1| unnamed protein product [Gallus gallus]
+          Length = 386
+
+ Score =  215 bits (548), Expect = 5e-055
+ Identities = 110/162 (67%), Positives = 132/162 (81%), Gaps = 2/162 (1%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           KMKILELPFASG +SMLVLLPDEVS LE++E  INFEKLTEWT+ N ME+R++KVYLP+M
+Sbjct: 227 KMKILELPFASGTMSMLVLLPDEVSGLEQLESIINFEKLTEWTSSNVMEERKIKVYLPRM 286
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGST 120
+           K+EEKYNLTSVLMA+G+TD+F  SANL+GISSAESLKISQAVH A  E++E G E+ GS
+Sbjct: 287 KMEEKYNLTSVLMAMGITDVFSSSANLSGISSAESLKISQAVHAAHAEINEAGREVVGSA 346
+
+Query: 121 GVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+                +  +  SE+FRADHPFLF IKH  TN +++FGR  SP
+Sbjct: 347 EA--GVDAASVSEEFRADHPFLFCIKHIATNAVLFFGRCVSP 386
+
+
+>pdb|1OVA|A Chain A, Ovalbumin (Egg Albumin)
+ pdb|1OVA|B Chain B, Ovalbumin (Egg Albumin)
+ pdb|1OVA|C Chain C, Ovalbumin (Egg Albumin)
+ pdb|1OVA|D Chain D, Ovalbumin (Egg Albumin)
+          Length = 386
+
+ Score =  215 bits (548), Expect = 5e-055
+ Identities = 110/162 (67%), Positives = 132/162 (81%), Gaps = 2/162 (1%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           KMKILELPFASG +SMLVLLPDEVS LE++E  INFEKLTEWT+ N ME+R++KVYLP+M
+Sbjct: 227 KMKILELPFASGTMSMLVLLPDEVSGLEQLESIINFEKLTEWTSSNVMEERKIKVYLPRM 286
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGST 120
+           K+EEKYNLTSVLMA+G+TD+F  SANL+GISSAESLKISQAVH A  E++E G E+ GS
+Sbjct: 287 KMEEKYNLTSVLMAMGITDVFSSSANLSGISSAESLKISQAVHAAHAEINEAGREVVGSA 346
+
+Query: 121 GVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+                +  +  SE+FRADHPFLF IKH  TN +++FGR  SP
+Sbjct: 347 EA--GVDAASVSEEFRADHPFLFCIKHIATNAVLFFGRCVSP 386
+
+
+>prf||0705172A ovalbumin
+          Length = 385
+
+ Score =  215 bits (548), Expect = 5e-055
+ Identities = 110/162 (67%), Positives = 132/162 (81%), Gaps = 2/162 (1%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           KMKILELPFASG +SMLVLLPDEVS LE++E  INFEKLTEWT+ N ME+R++KVYLP+M
+Sbjct: 226 KMKILELPFASGTMSMLVLLPDEVSGLEQLESIINFEKLTEWTSSNVMEERKIKVYLPRM 285
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGST 120
+           K+EEKYNLTSVLMA+G+TD+F  SANL+GISSAESLKISQAVH A  E++E G E+ GS
+Sbjct: 286 KMEEKYNLTSVLMAMGITDVFSSSANLSGISSAESLKISQAVHAAHAEINEAGREVVGSA 345
+
+Query: 121 GVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+                +  +  SE+FRADHPFLF IKH  TN +++FGR  SP
+Sbjct: 346 EA--GVDAASVSEEFRADHPFLFCIKHIATNAVLFFGRCVSP 385
+
+
+>gb|AAO43266.1| ovalbumin [Gallus gallus]
+          Length = 386
+
+ Score =  214 bits (544), Expect = 2e-054
+ Identities = 109/162 (67%), Positives = 131/162 (80%), Gaps = 2/162 (1%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           KMKILELPFASG +SMLVLLPDEVS LE++E  INFEKLTEWT+ N ME+R++KVY P+M
+Sbjct: 227 KMKILELPFASGTMSMLVLLPDEVSGLEQLESIINFEKLTEWTSSNVMEERKIKVYFPRM 286
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGST 120
+           K+EEKYNLTSVLMA+G+TD+F  SANL+GISSAESLKISQAVH A  E++E G E+ GS
+Sbjct: 287 KMEEKYNLTSVLMAMGITDVFSSSANLSGISSAESLKISQAVHAAHAEINEAGREVVGSA 346
+
+Query: 121 GVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+                +  +  SE+FRADHPFLF IKH  TN +++FGR  SP
+Sbjct: 347 EA--GVDAASVSEEFRADHPFLFCIKHIATNAVLFFGRCVSP 386
+
+
+>pdb|1UHG|A Chain A, Crystal Structure Of S-Ovalbumin At 1.9 Angstrom
+           Resolution
+ pdb|1UHG|B Chain B, Crystal Structure Of S-Ovalbumin At 1.9 Angstrom
+           Resolution
+ pdb|1UHG|C Chain C, Crystal Structure Of S-Ovalbumin At 1.9 Angstrom
+           Resolution
+ pdb|1UHG|D Chain D, Crystal Structure Of S-Ovalbumin At 1.9 Angstrom
+           Resolution
+          Length = 385
+
+ Score =  209 bits (533), Expect = 3e-053
+ Identities = 107/162 (66%), Positives = 129/162 (79%), Gaps = 2/162 (1%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           KMKILELPFA G +SMLVLLPDEVS LE++E  INFEKLTEWT+ N ME+R++KVYLP+M
+Sbjct: 226 KMKILELPFAXGTMSMLVLLPDEVSGLEQLESIINFEKLTEWTSSNVMEERKIKVYLPRM 285
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGST 120
+           K+EEKYNLTSVLMA+G+TD+F  SANL+GISSAE LKISQAVH A  E++E G E+ G
+Sbjct: 286 KMEEKYNLTSVLMAMGITDVFSSSANLSGISSAEXLKISQAVHAAHAEINEAGREVVGXA 345
+
+Query: 121 GVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+                +  +  SE+FRADHPFLF IKH  TN +++FGR  SP
+Sbjct: 346 EA--GVDAASVSEEFRADHPFLFCIKHIATNAVLFFGRCVSP 385
+
+
+>sp|O73860|OVAL_MELGA Ovalbumin (Egg albumin)
+ gb|AAC16664.1| ovalbumin [Meleagris gallopavo]
+          Length = 386
+
+ Score =  209 bits (531), Expect = 5e-053
+ Identities = 108/162 (66%), Positives = 130/162 (80%), Gaps = 2/162 (1%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           KMKILELPFASG +SM VLLPDEVS LE++E TI+FEK+TEW + N ME+RR+KVYLP+M
+Sbjct: 227 KMKILELPFASGTMSMWVLLPDEVSGLEQLETTISFEKMTEWISSNIMEERRIKVYLPRM 286
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGST 120
+           K+EEKYNLTSVLMA+G+TDLF  SANL+GISSA SLKISQA H A+ E+ E G E+ GS
+Sbjct: 287 KMEEKYNLTSVLMAMGITDLFSSSANLSGISSAGSLKISQAAHAAYAEIYEAGREVIGSA 346
+
+Query: 121 GVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+               D   +  SE+FR DHPFL+ IKHN TN+I++FGR  SP
+Sbjct: 347 EAGADA--TSVSEEFRVDHPFLYCIKHNLTNSILFFGRCISP 386
+
+
+>sp|Q6V115|OVAL_COTCO Ovalbumin (Egg albumin)
+ gb|AAQ22769.1| ovalbumin [Coturnix coturnix]
+          Length = 383
+
+ Score =  204 bits (518), Expect = 2e-051
+ Identities = 105/162 (64%), Positives = 129/162 (79%), Gaps = 5/162 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           KMKILELPFASG +SMLVLLPD+VS LE++E TI+FEKLTEWT+ + ME+R+VKVYLP+M
+Sbjct: 227 KMKILELPFASGTMSMLVLLPDDVSGLEQLESTISFEKLTEWTSSSIMEERKVKVYLPRM 286
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGST 120
+           K+EEKYNLTS+LMA+G+TDLF  SANL+GISS  SLKI QAVH A+ E++E G ++ GS
+Sbjct: 287 KMEEKYNLTSLLMAMGITDLFSSSANLSGISSVGSLKIPQAVHAAYAEINEAGRDVVGSA 346
+
+Query: 121 GVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+               D      +E+FRADHPFLF +KH  TN I+ FGR  SP
+Sbjct: 347 EAGVD-----ATEEFRADHPFLFCVKHIETNAILLFGRCVSP 383
+
+
+>sp|P19104|OVAL_COTJA Ovalbumin (Egg albumin)
+ emb|CAA37916.1| unnamed protein product [Coturnix coturnix]
+          Length = 383
+
+ Score =  202 bits (513), Expect = 6e-051
+ Identities = 105/162 (64%), Positives = 128/162 (79%), Gaps = 5/162 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           KMKILELPFASG +SMLVLLPD+VS LE++E  I+FEKLTEWT+ + ME+R+VKVYLP+M
+Sbjct: 227 KMKILELPFASGTMSMLVLLPDDVSGLEQLESIISFEKLTEWTSSSIMEERKVKVYLPRM 286
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGST 120
+           K+EEKYNLTS+LMA+G+TDLF  SANL+GISS  SLKISQAVH A  E++E G ++ GS
+Sbjct: 287 KMEEKYNLTSLLMAMGITDLFSSSANLSGISSVGSLKISQAVHAAHAEINEAGRDVVGSA 346
+
+Query: 121 GVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+               D      +E+FRADHPFLF +KH  TN I+ FGR  SP
+Sbjct: 347 EAGVD-----ATEEFRADHPFLFCVKHIETNAILLFGRCVSP 383
+
+
+>ref|XP_588377.2| PREDICTED: similar to SCCA2/SCCA1 fusion protein [Bos taurus]
+          Length = 413
+
+ Score =  164 bits (416), Expect = 1e-039
+ Identities = 80/161 (49%), Positives = 109/161 (67%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KILE+P+  G+LSM+VLLPDEV  L+ +E  +  EKL EWT+P  M  R V +YLP+ K+
+Sbjct: 253 KILEIPYKGGELSMMVLLPDEVDGLQEVEDQLTAEKLIEWTSPQNMGNREVDLYLPRFKV 312
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE YNL   L ALGM D F    AN +G++ +  L +S+ +H +F+E++E+G E A +TG
+Sbjct: 313 EESYNLVPTLQALGMVDAFCGGVANFSGMNGSRDLAVSKVIHKSFVEVTEEGTEAAAATG 372
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V+      P  E+FR DHPFLFLIKH  TN+I++ GR  SP
+Sbjct: 373 VVFTRTSLPFRERFRCDHPFLFLIKHIKTNSILFCGRVSSP 413
+
+
+>ref|XP_001331039.1| PREDICTED: hypothetical protein [Danio rerio]
+          Length = 384
+
+ Score =  163 bits (413), Expect = 2e-039
+ Identities = 78/167 (46%), Positives = 117/167 (70%), Gaps = 5/167 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K  +LELP+A  +LSML++LPDE+ D    L+++E+ + +EKL EWT P  M +R V+V
+Sbjct: 218 KSHVLELPYAGKNLSMLIILPDEIEDETTGLQKLERALTYEKLMEWTKPEVMHQREVQVS 277
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ K E+ Y++ S+L+++GM D+F P   NLTG+SS+  L +S+A+H AF+E++E+G E
+Sbjct: 278 LPKFKTEQTYDMKSLLVSMGMEDVFDPQKVNLTGMSSSNDLVLSKAIHKAFVEVNEEGTE 337
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +T  IE +        F ADHPFLF I+HNPT +I+++GR  SP
+Sbjct: 338 AAAATAAIEKLMCYIPPLSFNADHPFLFFIRHNPTKSILFYGRLCSP 384
+
+
+>ref|XP_697505.2| PREDICTED: similar to serine proteinase inhibitor, clade B, member
+           1 [Danio rerio]
+          Length = 437
+
+ Score =  163 bits (412), Expect = 3e-039
+ Identities = 75/165 (45%), Positives = 119/165 (72%), Gaps = 5/165 (3%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVYLP 58
+           ++LELP+   +LSML++LPD++ D    LE++EK + +EKL EWT P  M ++ V+V LP
+Sbjct: 273 QVLELPYVGKNLSMLIILPDQIEDATTGLEKLEKALTYEKLMEWTKPEVMRQQEVQVSLP 332
+
+Query: 59  QMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMA 117
+           + K+E+ Y++ S+L+++GM D+F P   NLTG+SS+  L +S+ +H AF+E++E+G E A
+Sbjct: 333 KFKMEQTYDMKSLLVSMGMEDVFDPQKVNLTGMSSSNDLVLSKVIHKAFVEVNEEGTEAA 392
+
+Query: 118 GSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            +TG I  ++     + F ADHPFLF I+HNPT +I+++GR+ SP
+Sbjct: 393 AATGAIMMLRCIRLPQSFNADHPFLFFIRHNPTKSILFYGRFCSP 437
+
+
+>ref|XP_001338768.1| PREDICTED: similar to Serpin peptidase inhibitor, clade B
+           (ovalbumin), member 1, like 4 [Danio rerio]
+          Length = 439
+
+ Score =  162 bits (410), Expect = 5e-039
+ Identities = 77/167 (46%), Positives = 121/167 (72%), Gaps = 7/167 (4%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVYLP 58
+           ++LELP+   +LSML++LPD++ D    L+++EK + +EKL EWT P+ M ++ V+V LP
+Sbjct: 273 QVLELPYVGKNLSMLIILPDQIEDATTGLQKLEKALTYEKLMEWTKPSMMCQQEVQVSLP 332
+
+Query: 59  QMKIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMA 117
+           + K E+ Y++ S+L+++GM D+F P   NLTG+SS+  L +S+ +H AF+E++E+G E A
+Sbjct: 333 KFKTEQTYDMKSLLVSMGMEDVFDPQKVNLTGMSSSNDLVLSKVIHKAFVEVNEEGTEAA 392
+
+Query: 118 GSTGVIEDIKHSPES--EQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            +TGVI  +   P S  + F ADHPF+F I+HNPTN I+++GR+ SP
+Sbjct: 393 AATGVIATLTSMPLSPPKTFTADHPFIFFIRHNPTNAILFYGRFSSP 439
+
+
+>ref|NP_001009892.1| serpin peptidase inhibitor, clade B (ovalbumin), member 1, like 1
+           [Danio rerio]
+ gb|AAQ97848.1| serine proteinase inhibitor, clade B, member 1 [Danio rerio]
+          Length = 384
+
+ Score =  161 bits (408), Expect = 9e-039
+ Identities = 77/167 (46%), Positives = 115/167 (68%), Gaps = 5/167 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K  +LELP+A  +LSML++LPDE+ D    LE++E+ + +EKL EWT P  M +R V+V
+Sbjct: 218 KSHVLELPYAGKNLSMLIILPDEIEDATTGLEKLERALTYEKLMEWTKPEVMHQREVQVS 277
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ K E+ Y++ S+L+++GM D+F P   NLTG+SS+  L +S+ +H AF+E++E+G E
+Sbjct: 278 LPKFKTEQTYDMKSLLVSMGMEDVFDPQKVNLTGMSSSNDLVLSKVIHKAFVEVNEEGTE 337
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +T  I           F ADHPFLF I+HNPT +I+++GR+ SP
+Sbjct: 338 AAAATAAIAKFLCYIPPVSFNADHPFLFFIRHNPTKSILFYGRFCSP 384
+
+
+>ref|XP_001254097.1| PREDICTED: similar to squamous cell carcinoma antigen [Bos taurus]
+          Length = 390
+
+ Score =  160 bits (405), Expect = 2e-038
+ Identities = 79/161 (49%), Positives = 108/161 (67%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KILE+P+   +LSMLVLLP+EV  L+ +E  +  EKL EWT+P  M  R V +YLP+ K+
+Sbjct: 230 KILEIPYKGEELSMLVLLPNEVDGLQEVEDQLTAEKLIEWTSPQNMGNREVDLYLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE YNL   L ALGM D F    AN +G++ +  L +S+ +H +F+E++E+G E A +TG
+Sbjct: 290 EESYNLVPTLQALGMVDAFCGGVANFSGMNGSRDLAVSKVIHKSFVEVTEEGTEAAAATG 349
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V+      P  E+FR DHPFLFLIKH  TN+I++ GR  SP
+Sbjct: 350 VVFTRTSLPFRERFRCDHPFLFLIKHIKTNSILFCGRVSSP 390
+
+
+>ref|NP_956235.1| serpin peptidase inhibitor, clade B (ovalbumin), member 1, like 4
+           [Danio rerio]
+ gb|AAH64292.1| Serpin peptidase inhibitor, clade B (ovalbumin), member 1, like 4
+           [Danio rerio]
+          Length = 393
+
+ Score =  156 bits (395), Expect = 3e-037
+ Identities = 77/165 (46%), Positives = 119/165 (72%), Gaps = 9/165 (5%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVYLP 58
+           +ILELP+   +LSML++LPDE+ D    L+++EK + +EKL +WT    M ++ V+V LP
+Sbjct: 233 QILELPYVGKNLSMLIILPDEIEDATTGLQKLEKALTYEKLMQWTK--VMRQQEVQVSLP 290
+
+Query: 59  QMKIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMA 117
+           + K E+ Y++ S+L+++GM D+F P   NLTG+SS+  L +S+ VH AF+E++E+G E A
+Sbjct: 291 KFKTEQTYDMKSLLVSMGMEDVFDPLKVNLTGMSSSNDLVLSKVVHKAFVEVNEEGTEAA 350
+
+Query: 118 GSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            +TG +  I+    ++ F ADHPFLF I+HNPTNTI+++GR+ SP
+Sbjct: 351 AATGAVVSIRTL--AQIFNADHPFLFFIRHNPTNTILFYGRFCSP 393
+
+
+>ref|XP_001254054.1| PREDICTED: similar to SCCA2/SCCA1 fusion protein [Bos taurus]
+ ref|XP_001254515.1| PREDICTED: similar to SCCA2/SCCA1 fusion protein [Bos taurus]
+ ref|XP_001254617.1| PREDICTED: similar to SCCA2/SCCA1 fusion protein [Bos taurus]
+ ref|XP_001254777.1| PREDICTED: similar to SCCA2/SCCA1 fusion protein [Bos taurus]
+          Length = 390
+
+ Score =  156 bits (394), Expect = 4e-037
+ Identities = 80/161 (49%), Positives = 106/161 (65%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KILE+P+   +LSMLVLLP+EV  L+ +E  +  EKL  WT+P  M KR V +YLP+ K+
+Sbjct: 230 KILEIPYKGEELSMLVLLPNEVDGLQELEDQLTAEKLIAWTSPQNMGKREVDLYLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFI-PSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE YNL   L ALGM D FI   AN +G++    L +S+  H +F+E++E+G E A +TG
+Sbjct: 290 EESYNLVPTLRALGMVDAFIFRVANFSGMNGRRDLVVSKVFHKSFVEVTEEGTEAAAATG 349
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V+      P  E FR DHPFLFLIKH  TN+I++ GR  SP
+Sbjct: 350 VVIIRTSLPFREPFRCDHPFLFLIKHIKTNSILFCGRVSSP 390
+
+
+>ref|XP_001254469.1| PREDICTED: similar to squamous cell carcinoma antigen [Bos taurus]
+          Length = 390
+
+ Score =  155 bits (391), Expect = 8e-037
+ Identities = 77/161 (47%), Positives = 108/161 (67%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KILE+P+   +LSM+VLLP+EV  L+ +E  +  EKL  WT+P  M KR V +YLP+ K+
+Sbjct: 230 KILEIPYKGEELSMMVLLPNEVDGLQELEDQLTAEKLIAWTSPQNMGKREVDLYLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y+L   L ALGM D F    AN +G++ +  L +S+ +H +F+E++E+G E A +TG
+Sbjct: 290 EESYDLVPTLKALGMVDAFRGGVANFSGMNGSRDLAVSKVIHKSFVEVTEEGTEAAAATG 349
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V+      P  E+FR DHPFLFLIKH  TN+I++ GR  SP
+Sbjct: 350 VVIIRTSLPFRERFRCDHPFLFLIKHIKTNSILFCGRVSSP 390
+
+
+>emb|CAF98804.1| unnamed protein product [Tetraodon nigroviridis]
+          Length = 405
+
+ Score =  154 bits (390), Expect = 1e-036
+ Identities = 74/167 (44%), Positives = 118/167 (70%), Gaps = 5/167 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILE+P+   +LSML+ LP ++ D    LE++EK + ++K  EWT P+ M+   V+V
+Sbjct: 238 KCQILEMPYIGEELSMLIFLPYQMEDSSTGLEKLEKLLTYDKFMEWTRPDMMDSVEVQVG 297
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ K+EEK+N+ +VL+ +GM + F + ++N +G+S A  L +S+ VH AF+E++E+G E
+Sbjct: 298 LPRFKLEEKFNMKNVLVKMGMVEAFDVATSNFSGMSPANDLFLSEVVHKAFVEVNEEGTE 357
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +TG I  ++ +  SE+F ADHPFLF I+HNP+ +I++ GRY SP
+Sbjct: 358 AAAATGAIMMLRCARPSERFYADHPFLFFIRHNPSMSILFAGRYCSP 404
+
+
+>ref|XP_001254815.1| PREDICTED: similar to SCCA2/SCCA1 fusion protein [Bos taurus]
+ ref|XP_876359.2| PREDICTED: similar to SCCA2/SCCA1 fusion protein [Bos taurus]
+ ref|XP_001254816.1| PREDICTED: similar to SCCA2/SCCA1 fusion protein [Bos taurus]
+          Length = 391
+
+ Score =  154 bits (389), Expect = 1e-036
+ Identities = 79/162 (48%), Positives = 109/162 (67%), Gaps = 2/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KILE+P+   +LSM+VLLP+EV  L+ +E  +  EKL  WT+P  M KR V +YLP+ K+
+Sbjct: 230 KILEIPYKGEELSMMVLLPNEVDGLQELEDQLTAEKLIAWTSPQNMRKREVDLYLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFI-PSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y+L + L ALGM D FI   AN +G++ +  L IS+  H +F+E++E+G E A +TG
+Sbjct: 290 EESYDLVATLRALGMVDAFIFRVANFSGMTGSGDLAISKVFHKSFVEVTEEGTEAAAATG 349
+
+Query: 122 V-IEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V +  +   P  E FR DHPFLFLIKH  TN+I++ GR  SP
+Sbjct: 350 VGVAVLTSLPIRESFRCDHPFLFLIKHIKTNSILFCGRVSSP 391
+
+
+>ref|XP_597345.3| PREDICTED: similar to squamous cell carcinoma antigen; SCC antigen
+           [Bos taurus]
+ ref|XP_001254672.1| PREDICTED: similar to squamous cell carcinoma antigen; SCC antigen
+           [Bos taurus]
+          Length = 390
+
+ Score =  153 bits (386), Expect = 3e-036
+ Identities = 77/161 (47%), Positives = 105/161 (65%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KILE+P+   +LSMLVLLP+EV  L+ +E  +  EKL  WT+P  M KR V +YLP+ K+
+Sbjct: 230 KILEIPYKGEELSMLVLLPNEVDGLQELEDQLTAEKLIAWTSPQNMRKREVDLYLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y+L   L ALGM D F    A+ +G++    L +S+  H  F+E++E+G E A +TG
+Sbjct: 290 EESYDLVPTLRALGMVDAFRDGVADFSGMTGGRDLVVSKVFHKCFVEVTEEGTEAAAATG 349
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V   +  +P  E FR DHPFLFLIKH  TN+I++ GR  SP
+Sbjct: 350 VGVRVLSAPFRESFRCDHPFLFLIKHIKTNSILFCGRVSSP 390
+
+
+>ref|XP_001365788.1| PREDICTED: similar to SERPINB11d [Monodelphis domestica]
+          Length = 391
+
+ Score =  152 bits (383), Expect = 7e-036
+ Identities = 75/163 (46%), Positives = 116/163 (71%), Gaps = 2/163 (1%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           +M++LELP+ASG+LSM+VLLP +   +E+IEK +N +   +WTN + M +R V V+ P+
+Sbjct: 230 QMQVLELPYASGNLSMIVLLPKDTDQIEQIEKQLNLKTFKQWTN-SLMTEREVDVHFPRF 288
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGS 119
+           K+  KY L S+L ALG+TD+F    A+L+G+S +  L +S+ +H +F++++E+G E + +
+Sbjct: 289 KLGMKYELNSLLKALGITDIFDHLKADLSGLSPSRELYLSKVIHESFVDVNEEGTEASAA 348
+
+Query: 120 TGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           TG I  +K  P  ++F ADHPFLF IKH  TNTI++ GR+ SP
+Sbjct: 349 TGDIVVVKRLPIRDRFIADHPFLFFIKHINTNTILFCGRFSSP 391
+
+
+>ref|XP_589083.3| PREDICTED: similar to SCCA2/SCCA1 fusion protein [Bos taurus]
+          Length = 390
+
+ Score =  151 bits (382), Expect = 9e-036
+ Identities = 76/161 (47%), Positives = 105/161 (65%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KILE+P+   +LSM+VLLPDEV  L+ +E  +  EKL  WT+P  M KR+V +YLP+ K+
+Sbjct: 230 KILEIPYKGSELSMMVLLPDEVDGLQELEDQLTAEKLIAWTSPQNMRKRQVDLYLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y+L   L ALGM D F    A+ +G++    L +S+  H  F+E++E+G E A +TG
+Sbjct: 290 EESYDLVPTLQALGMVDAFRDGVADFSGMTGGRDLVVSKVFHKCFVEVTEEGTEAAAATG 349
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V    +    SE FR +HPFLFLIKH  TN+I++ GR  SP
+Sbjct: 350 VEIIERAGRNSESFRCNHPFLFLIKHIKTNSILFCGRVSSP 390
+
+
+>ref|XP_001148581.1| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 10 isoform 3 [Pan troglodytes]
+          Length = 711
+
+ Score =  151 bits (382), Expect = 9e-036
+ Identities = 74/159 (46%), Positives = 113/159 (71%), Gaps = 1/159 (0%)
+
+Query: 5   LELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEE 64
+           L+L + S DLS+L+LLP++++ LE++EK I +EKL EWT+ + ME   V+++LP+ K+E+
+Sbjct: 553 LQLYYKSRDLSLLILLPEDINGLEQLEKAITYEKLNEWTSADMMELYEVQLHLPKFKLED 612
+
+Query: 65  KYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVI 123
+            Y+L S L ++GM+D F  S A+ +G+SSA +L +S   H AF+E++E G E A  +G
+Sbjct: 613 SYDLKSTLSSMGMSDAFSQSKADFSGMSSARNLFLSNVFHKAFVEINEQGTEAAAGSGSE 672
+
+Query: 124 EDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            DI+    S +F A+HPFLF I+HN TNTI+++GR  SP
+Sbjct: 673 IDIRIRVPSIEFNANHPFLFFIRHNKTNTILFYGRLCSP 711
+
+
+
+ Score = 52.0 bits (123), Expect = 1e-005
+ Identities = 27/64 (42%), Positives = 45/64 (70%), Gaps = 5/64 (7%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILELP+A G++SM +LLPDE++D    LE +E  I ++KL +WT+ + M +  V++
+Sbjct: 250 KAQILELPYA-GNVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKMAEDDVELK 308
+
+Query: 57  LPQM 60
+           + Q+
+Sbjct: 309 VSQL 312
+
+
+>ref|XP_001148652.1| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 10 isoform 4 [Pan troglodytes]
+          Length = 733
+
+ Score =  151 bits (382), Expect = 9e-036
+ Identities = 74/159 (46%), Positives = 113/159 (71%), Gaps = 1/159 (0%)
+
+Query: 5   LELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEE 64
+           L+L + S DLS+L+LLP++++ LE++EK I +EKL EWT+ + ME   V+++LP+ K+E+
+Sbjct: 575 LQLYYKSRDLSLLILLPEDINGLEQLEKAITYEKLNEWTSADMMELYEVQLHLPKFKLED 634
+
+Query: 65  KYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVI 123
+            Y+L S L ++GM+D F  S A+ +G+SSA +L +S   H AF+E++E G E A  +G
+Sbjct: 635 SYDLKSTLSSMGMSDAFSQSKADFSGMSSARNLFLSNVFHKAFVEINEQGTEAAAGSGSE 694
+
+Query: 124 EDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            DI+    S +F A+HPFLF I+HN TNTI+++GR  SP
+Sbjct: 695 IDIRIRVPSIEFNANHPFLFFIRHNKTNTILFYGRLCSP 733
+
+
+
+ Score = 52.0 bits (123), Expect = 1e-005
+ Identities = 27/64 (42%), Positives = 45/64 (70%), Gaps = 5/64 (7%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILELP+A G++SM +LLPDE++D    LE +E  I ++KL +WT+ + M +  V++
+Sbjct: 250 KAQILELPYA-GNVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKMAEDDVELK 308
+
+Query: 57  LPQM 60
+           + Q+
+Sbjct: 309 VSQL 312
+
+
+>sp|P80229|ILEU_PIG Leukocyte elastase inhibitor (LEI) (Serpin B1) (Leukocyte neutral
+           proteinase inhibitor) (LNPI)
+          Length = 378
+
+ Score =  151 bits (382), Expect = 9e-036
+ Identities = 76/166 (45%), Positives = 108/166 (65%), Gaps = 4/166 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K ++LELP+   DLSM++LLPD + D    L +IE+ +  EKL EWT P+ +E   V V+
+Sbjct: 213 KCRVLELPYQGKDLSMVILLPDSIEDESTGLRKIEQHLTLEKLNEWTKPDNLELLEVNVH 272
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEM 116
+           LP+ ++EE Y+L + L  LG+ DLF   A+LTG+S A  L IS+ VH AF+E++E+G E
+Sbjct: 273 LPRFRLEESYDLNAPLARLGVQDLFGSRADLTGMSEARDLFISKVVHKAFVEVNEEGTEA 332
+
+Query: 117 AGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           A +T  I         E F ADHPF+F I+HNP++ I++ GR  SP
+Sbjct: 333 AAATAGIAVFAMLMPEEDFIADHPFIFFIRHNPSSNILFLGRLSSP 378
+
+
+>ref|NP_005015.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 10 [Homo sapiens]
+ sp|P48595|SPB10_HUMAN Serpin B10 (Bomapin) (Protease inhibitor 10)
+ gb|AAC50282.1| bomapin
+ gb|AAH96220.1| Serpin peptidase inhibitor, clade B (ovalbumin), member 10 [Homo
+           sapiens]
+ gb|AAH96219.1| Serpin peptidase inhibitor, clade B (ovalbumin), member 10 [Homo
+           sapiens]
+ gb|EAW63162.1| serpin peptidase inhibitor, clade B (ovalbumin), member 10 [Homo
+           sapiens]
+          Length = 397
+
+ Score =  151 bits (382), Expect = 9e-036
+ Identities = 74/159 (46%), Positives = 113/159 (71%), Gaps = 1/159 (0%)
+
+Query: 5   LELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEE 64
+           L+L + S DLS+L+LLP++++ LE++EK I +EKL EWT+ + ME   V+++LP+ K+E+
+Sbjct: 239 LQLYYKSRDLSLLILLPEDINGLEQLEKAITYEKLNEWTSADMMELYEVQLHLPKFKLED 298
+
+Query: 65  KYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVI 123
+            Y+L S L ++GM+D F  S A+ +G+SSA +L +S   H AF+E++E G E A  +G
+Sbjct: 299 SYDLKSTLSSMGMSDAFSQSKADFSGMSSARNLFLSNVFHKAFVEINEQGTEAAAGSGSE 358
+
+Query: 124 EDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            DI+    S +F A+HPFLF I+HN TNTI+++GR  SP
+Sbjct: 359 IDIRIRVPSIEFNANHPFLFFIRHNKTNTILFYGRLCSP 397
+
+
+>ref|NP_035589.1| serine (or cysteine) proteinase inhibitor, clade B, member 8 [Mus
+           musculus]
+ sp|O08800|SPB8_MOUSE Serpin B8
+ gb|AAB57815.2| NK10 [Mus musculus]
+ gb|AAH25121.1| Serine (or cysteine) peptdiase inhibitor, clade B, member 8 [Mus
+           musculus]
+ dbj|BAC29588.1| unnamed protein product [Mus musculus]
+          Length = 374
+
+ Score =  151 bits (382), Expect = 9e-036
+ Identities = 71/162 (43%), Positives = 116/162 (71%), Gaps = 1/162 (0%)
+
+Query: 2   MKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMK 61
+           M++L LP+A  +LSM++LLPDE +DL  +EK + +EKL  WTNP T+ + +V+V+LP++K
+Sbjct: 213 MQVLALPYAEEELSMVILLPDESTDLAVVEKALTYEKLRAWTNPETLTESQVQVFLPRLK 272
+
+Query: 62  IEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGST 120
+           +EE Y+L +VL  LGMTD F  + A+ +G+++ +++ +S+  H  F+E++E+G E A +T
+Sbjct: 273 LEESYDLETVLQNLGMTDAFEETRADFSGMTTKKNVPVSKVAHKCFVEVNEEGTEAAAAT 332
+
+Query: 121 GVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            VI + +      +F ADHPFLF I H+ T++I++ GR+ SP
+Sbjct: 333 AVIRNARCCRTEPRFCADHPFLFFIWHHKTSSILFCGRFSSP 374
+
+
+>ref|XP_001254391.1| PREDICTED: similar to squamous cell carcinoma antigen [Bos taurus]
+          Length = 390
+
+ Score =  151 bits (381), Expect = 1e-035
+ Identities = 77/161 (47%), Positives = 106/161 (65%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KILE+P+   +LSMLVLLP+EV  L+ +E  +  EKL  WT+P  M KR V +YLP+ K+
+Sbjct: 230 KILEIPYKGEELSMLVLLPNEVDGLQELEDQLTAEKLIAWTSPQNMGKREVDLYLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE YNL   L ALGM D F    A+ +G++ +  L +S+  H +F+E++E+G E A +TG
+Sbjct: 290 EESYNLVPTLQALGMVDAFRGGVADFSGMTGSRDLAVSKVFHKSFVEVTEEGTEAAAATG 349
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V+   K     E FR +HPFLFLIKH  TN+I++ GR  SP
+Sbjct: 350 VVIIRKSLTFREPFRCNHPFLFLIKHIKTNSILFCGRVSSP 390
+
+
+>ref|XP_001253954.1| PREDICTED: similar to SCCA2/SCCA1 fusion protein [Bos taurus]
+          Length = 390
+
+ Score =  151 bits (381), Expect = 1e-035
+ Identities = 77/161 (47%), Positives = 106/161 (65%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KILE+P+   +LSMLVLLP+EV  L+ +E  +  EKL  WT+P  M KR V +YLP+ K+
+Sbjct: 230 KILEIPYKGEELSMLVLLPNEVDGLQELEDQLTAEKLIAWTSPQNMGKREVDLYLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE YNL   L ALGM D F    A+ +G++ +  L +S+  H +F+E++E+G E A +TG
+Sbjct: 290 EESYNLVPTLQALGMVDAFRGGVADFSGMTGSRDLAVSKVFHKSFVEVTEEGTEAAAATG 349
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V+   K     E FR +HPFLFLIKH  TN+I++ GR  SP
+Sbjct: 350 VVIIRKSLTFREPFRCNHPFLFLIKHIKTNSILFCGRVSSP 390
+
+
+>gb|AAH96218.1| Serpin peptidase inhibitor, clade B (ovalbumin), member 10 [Homo
+           sapiens]
+          Length = 397
+
+ Score =  151 bits (381), Expect = 1e-035
+ Identities = 74/159 (46%), Positives = 113/159 (71%), Gaps = 1/159 (0%)
+
+Query: 5   LELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEE 64
+           L+L + S DLS+L+LLP++++ LE++EK I +EKL EWT+ + ME   V+++LP+ K+E+
+Sbjct: 239 LQLYYKSCDLSLLILLPEDINGLEQLEKAITYEKLNEWTSADMMELYEVQLHLPKFKLED 298
+
+Query: 65  KYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVI 123
+            Y+L S L ++GM+D F  S A+ +G+SSA +L +S   H AF+E++E G E A  +G
+Sbjct: 299 SYDLKSTLSSMGMSDAFSQSKADFSGMSSARNLFLSNVFHKAFVEINEQGTEAAAGSGSE 358
+
+Query: 124 EDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            DI+    S +F A+HPFLF I+HN TNTI+++GR  SP
+Sbjct: 359 IDIRIRVPSIEFNANHPFLFFIRHNKTNTILFYGRLCSP 397
+
+
+>ref|XP_001254421.1| PREDICTED: similar to SCCA2/SCCA1 fusion protein [Bos taurus]
+ ref|XP_001250959.1| PREDICTED: similar to SCCA2/SCCA1 fusion protein isoform 1 [Bos
+           taurus]
+ ref|XP_001254729.1| PREDICTED: similar to SCCA2/SCCA1 fusion protein [Bos taurus]
+          Length = 391
+
+ Score =  150 bits (380), Expect = 2e-035
+ Identities = 78/162 (48%), Positives = 106/162 (65%), Gaps = 2/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KILE+P+   +LSM+VLLP+EV  L+ +E  +  EKL  WT+P  M KR V +YLP+ K+
+Sbjct: 230 KILEIPYKGEELSMMVLLPNEVDGLQELEDQLTAEKLIAWTSPQNMGKREVDLYLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y+L   L ALGM D F    AN +G++    L +S+  H +F+E++E+G E A +TG
+Sbjct: 290 EESYDLVPTLKALGMVDAFNDKVANFSGMTGRRDLVVSKVFHKSFVEVTEEGTEAAAATG 349
+
+Query: 122 V-IEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V +  I   P  E FR DHPFLFLIKH  TN+I++ GR  SP
+Sbjct: 350 VGVAVITSLPIRESFRCDHPFLFLIKHIKTNSILFGGRVSSP 391
+
+
+>gb|ABC70735.1| SERPINB4 [Papio papio]
+          Length = 379
+
+ Score =  150 bits (380), Expect = 2e-035
+ Identities = 70/162 (43%), Positives = 114/162 (70%), Gaps = 3/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K+LE+P+   DLSM+VLLP+E++ L+++E+ +  EKL EWT+   M +  V ++LP+ K+
+Sbjct: 219 KVLEIPYKGKDLSMIVLLPNEINGLQKLEEKLTAEKLLEWTSLQNMREAHVDLHLPRFKV 278
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM DLF   A+L+G++ +  L +S+ +H AF+E++E+G E A +T V
+Sbjct: 279 EESYDLKDTLRNMGMVDLFNGDADLSGMTGSHGLTVSKVLHKAFVEVTEEGAEAAAATAV 338
+
+Query: 123 IEDIKHSP--ESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           + ++  SP   +E+F  +HPFLF I+ N TN+I++FGR+ SP
+Sbjct: 339 VTELS-SPLLTNEEFHCNHPFLFFIRQNKTNSILFFGRFSSP 379
+
+
+>ref|XP_856912.1| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B (ovalbumin), member 8 isoform a isoform 4 [Canis
+           familiaris]
+          Length = 378
+
+ Score =  150 bits (380), Expect = 2e-035
+ Identities = 70/161 (43%), Positives = 113/161 (70%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +ILELP+A  +LSM++LLPD+ +DL  +EK + +EK   WT+P  M K +V+V+LP++K+
+Sbjct: 218 QILELPYAGEELSMVILLPDDNTDLAEVEKALTYEKFRAWTDPENMTKNKVQVFLPRLKL 277
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y+L S L ++GM D F  + A+ +G+S+ +++ +S+  H  F+E++E+G E A +T
+Sbjct: 278 EESYDLESFLRSVGMIDAFEEAKADFSGMSAKKNVPVSKVAHKCFVEVNEEGTEAAAATA 337
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V+ + + S    +F ADHPFLF I H  TN+I++ GR+ SP
+Sbjct: 338 VVRNARCSRAEPRFCADHPFLFFIIHRHTNSILFCGRFCSP 378
+
+
+>ref|XP_848751.1| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B (ovalbumin), member 8 isoform a isoform 1 [Canis
+           familiaris]
+          Length = 374
+
+ Score =  150 bits (380), Expect = 2e-035
+ Identities = 70/161 (43%), Positives = 113/161 (70%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +ILELP+A  +LSM++LLPD+ +DL  +EK + +EK   WT+P  M K +V+V+LP++K+
+Sbjct: 214 QILELPYAGEELSMVILLPDDNTDLAEVEKALTYEKFRAWTDPENMTKNKVQVFLPRLKL 273
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y+L S L ++GM D F  + A+ +G+S+ +++ +S+  H  F+E++E+G E A +T
+Sbjct: 274 EESYDLESFLRSVGMIDAFEEAKADFSGMSAKKNVPVSKVAHKCFVEVNEEGTEAAAATA 333
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V+ + + S    +F ADHPFLF I H  TN+I++ GR+ SP
+Sbjct: 334 VVRNARCSRAEPRFCADHPFLFFIIHRHTNSILFCGRFCSP 374
+
+
+>ref|XP_856828.1| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B (ovalbumin), member 8 isoform a isoform 2 [Canis
+           familiaris]
+          Length = 382
+
+ Score =  150 bits (380), Expect = 2e-035
+ Identities = 70/161 (43%), Positives = 113/161 (70%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +ILELP+A  +LSM++LLPD+ +DL  +EK + +EK   WT+P  M K +V+V+LP++K+
+Sbjct: 222 QILELPYAGEELSMVILLPDDNTDLAEVEKALTYEKFRAWTDPENMTKNKVQVFLPRLKL 281
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y+L S L ++GM D F  + A+ +G+S+ +++ +S+  H  F+E++E+G E A +T
+Sbjct: 282 EESYDLESFLRSVGMIDAFEEAKADFSGMSAKKNVPVSKVAHKCFVEVNEEGTEAAAATA 341
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V+ + + S    +F ADHPFLF I H  TN+I++ GR+ SP
+Sbjct: 342 VVRNARCSRAEPRFCADHPFLFFIIHRHTNSILFCGRFCSP 382
+
+
+>ref|XP_856871.1| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B (ovalbumin), member 8 isoform a isoform 3 [Canis
+           familiaris]
+          Length = 379
+
+ Score =  150 bits (380), Expect = 2e-035
+ Identities = 70/161 (43%), Positives = 113/161 (70%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +ILELP+A  +LSM++LLPD+ +DL  +EK + +EK   WT+P  M K +V+V+LP++K+
+Sbjct: 219 QILELPYAGEELSMVILLPDDNTDLAEVEKALTYEKFRAWTDPENMTKNKVQVFLPRLKL 278
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y+L S L ++GM D F  + A+ +G+S+ +++ +S+  H  F+E++E+G E A +T
+Sbjct: 279 EESYDLESFLRSVGMIDAFEEAKADFSGMSAKKNVPVSKVAHKCFVEVNEEGTEAAAATA 338
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V+ + + S    +F ADHPFLF I H  TN+I++ GR+ SP
+Sbjct: 339 VVRNARCSRAEPRFCADHPFLFFIIHRHTNSILFCGRFCSP 379
+
+
+>gb|AAI30371.1| SERPINB11 protein [Homo sapiens]
+ gb|AAI30373.1| SERPINB11 protein [Homo sapiens]
+          Length = 278
+
+ Score =  150 bits (378), Expect = 3e-035
+ Identities = 72/163 (44%), Positives = 116/163 (71%), Gaps = 1/163 (0%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           +M++LELP+ +  LSM++LLP  +++L++IEK +N     EWT+ + M +R V+V+LP+
+Sbjct: 116 QMQVLELPYVNNKLSMIILLPVGIANLKQIEKQLNSGTFHEWTSSSNMMEREVEVHLPRF 175
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGS 119
+           K+E KY L S+L +LG+TDLF    A+L+G+S  + L +S+A+H +++++SE+G E A +
+Sbjct: 176 KLETKYELNSLLKSLGVTDLFNQVKADLSGMSPTKGLYLSKAIHKSYLDVSEEGTEAAAA 235
+
+Query: 120 TGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           TG    +K  P   QF+A+HPFLF I+H  TNTI++ G+  SP
+Sbjct: 236 TGDSTAVKSLPMRAQFKANHPFLFFIRHTHTNTILFCGKLASP 278
+
+
+>ref|XP_001232382.1| PREDICTED: similar to Chain A, Crystal Structure Of A M-Loop
+           Deletion Variant Of Ment In The Native Conformation
+           isoform 1 [Gallus gallus]
+          Length = 407
+
+ Score =  150 bits (378), Expect = 3e-035
+ Identities = 77/167 (46%), Positives = 113/167 (67%), Gaps = 6/167 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K KI+ELP+   +LSM VLLPD++SD    LE +E+ +  EKL EW+N   M K  V++Y
+Sbjct: 242 KFKIIELPYVENELSMFVLLPDDISDNTTGLELVERELTHEKLAEWSNSARMMKVEVELY 301
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP++KIEE Y+LTS L  +G+ + F P  A+ T +S+ +   +S+ +H AF+E++E+G E
+Sbjct: 302 LPKLKIEENYDLTSTLSNMGIQNAFDPVQADFTRMSAKKDFFLSKVIHKAFVEVNEEGTE 361
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +TGV+     +P    F+ADHPFLF I+HN + TI++FGR  SP
+Sbjct: 362 AAAATGVLVLRSRTPR-VTFKADHPFLFFIRHNKSKTILFFGRLCSP 407
+
+
+>ref|XP_426040.1| PREDICTED: similar to Chain A, Crystal Structure Of A M-Loop
+           Deletion Variant Of Ment In The Native Conformation
+           isoform 2 [Gallus gallus]
+          Length = 378
+
+ Score =  150 bits (378), Expect = 3e-035
+ Identities = 77/167 (46%), Positives = 113/167 (67%), Gaps = 6/167 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K KI+ELP+   +LSM VLLPD++SD    LE +E+ +  EKL EW+N   M K  V++Y
+Sbjct: 213 KFKIIELPYVENELSMFVLLPDDISDNTTGLELVERELTHEKLAEWSNSARMMKVEVELY 272
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP++KIEE Y+LTS L  +G+ + F P  A+ T +S+ +   +S+ +H AF+E++E+G E
+Sbjct: 273 LPKLKIEENYDLTSTLSNMGIQNAFDPVQADFTRMSAKKDFFLSKVIHKAFVEVNEEGTE 332
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +TGV+     +P    F+ADHPFLF I+HN + TI++FGR  SP
+Sbjct: 333 AAAATGVLVLRSRTPR-VTFKADHPFLFFIRHNKSKTILFFGRLCSP 378
+
+
+>dbj|BAE28539.1| unnamed protein product [Mus musculus]
+          Length = 374
+
+ Score =  150 bits (378), Expect = 3e-035
+ Identities = 70/162 (43%), Positives = 115/162 (70%), Gaps = 1/162 (0%)
+
+Query: 2   MKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMK 61
+           M++L LP+A  +LSM++LLPDE +DL  +EK + +EKL  WTNP T+ + +V+V+ P++K
+Sbjct: 213 MQVLALPYAEEELSMVILLPDESTDLAVVEKALTYEKLRAWTNPETLTESQVQVFFPRLK 272
+
+Query: 62  IEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGST 120
+           +EE Y+L +VL  LGMTD F  + A+ +G+++ +++ +S+  H  F+E++E+G E A +T
+Sbjct: 273 LEESYDLETVLQNLGMTDAFEETRADFSGMTTKKNVPVSKVAHKCFVEVNEEGTEAAAAT 332
+
+Query: 121 GVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            VI + +      +F ADHPFLF I H+ T++I++ GR+ SP
+Sbjct: 333 AVIRNARCCRTEPRFCADHPFLFFIWHHKTSSILFCGRFSSP 374
+
+
+>ref|XP_001090785.1| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 4 [Macaca mulatta]
+          Length = 390
+
+ Score =  149 bits (377), Expect = 4e-035
+ Identities = 69/162 (42%), Positives = 114/162 (70%), Gaps = 3/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K+LE+P+   DLSM+VLLP+E++ L+++E+ +  EKL EWT+   M +  V ++LP+ K+
+Sbjct: 230 KVLEIPYKGKDLSMIVLLPNEINGLQKLEEKLTAEKLLEWTSLQNMREAHVDLHLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM DLF   A+L+G++ +  L +S+ +H AF+E++E+G E A +T +
+Sbjct: 290 EESYDLKDTLRNMGMVDLFNGDADLSGMTGSRGLTVSKVLHKAFVEVTEEGAEAAATTAL 349
+
+Query: 123 IEDIKHSP--ESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           + ++  SP   +E+F  +HPFLF I+ N TN+I++FGR+ SP
+Sbjct: 350 VTELS-SPLLTNEEFHCNHPFLFFIRQNKTNSILFFGRFSSP 390
+
+
+>gb|AAH96217.1| Serpin peptidase inhibitor, clade B (ovalbumin), member 10 [Homo
+           sapiens]
+          Length = 397
+
+ Score =  149 bits (377), Expect = 4e-035
+ Identities = 73/159 (45%), Positives = 113/159 (71%), Gaps = 1/159 (0%)
+
+Query: 5   LELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEE 64
+           L+L + S DLS+L+LLP++++ LE++EK I +EKL EWT+ + ME   V+++LP+ K+E+
+Sbjct: 239 LQLYYKSRDLSLLILLPEDINGLEQLEKAITYEKLNEWTSADMMELYEVQLHLPKFKLED 298
+
+Query: 65  KYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVI 123
+            Y+L S L ++GM+D F  S A+ +G+SSA +L +S   H AF+E++E G E A  +G
+Sbjct: 299 SYDLKSTLSSMGMSDAFSQSKADFSGMSSARNLFLSNVFHKAFVEINEQGTEAAAGSGSE 358
+
+Query: 124 EDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            +I+    S +F A+HPFLF I+HN TNTI+++GR  SP
+Sbjct: 359 INIRIRVPSIEFNANHPFLFFIRHNKTNTILFYGRLCSP 397
+
+
+>pir||S38962 serpin - pig
+          Length = 378
+
+ Score =  149 bits (377), Expect = 4e-035
+ Identities = 75/166 (45%), Positives = 108/166 (65%), Gaps = 4/166 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K ++LELP+   DLSM++LLPD + D    L +IE+ +  EKL EWT P+ +E   V V+
+Sbjct: 213 KCRVLELPYQGKDLSMVILLPDSIEDESTGLRKIEQHLTLEKLREWTKPDNLELLEVNVH 272
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEM 116
+           LP+ ++EE Y+L + L  LG+ DLF   A+LTG+S A  L IS+ VH +F+E++E+G E
+Sbjct: 273 LPRFRLEESYDLNAPLARLGVQDLFGSRADLTGMSEARDLFISKVVHKSFVEVNEEGTEA 332
+
+Query: 117 AGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           A +T  I         E F ADHPF+F I+HNP++ I++ GR  SP
+Sbjct: 333 AAATXGIAVFAMLMPEEDFIADHPFIFFIRHNPSSNILFLGRLSSP 378
+
+
+>ref|XP_523958.2| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 11 [Pan troglodytes]
+          Length = 392
+
+ Score =  149 bits (376), Expect = 5e-035
+ Identities = 73/163 (44%), Positives = 116/163 (71%), Gaps = 1/163 (0%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           +M++LELP+ +  LSM++LLP   ++L++IEK +N     EWT+ + M +R V+V+LP+
+Sbjct: 230 QMQVLELPYVNNKLSMIILLPVGTANLKQIEKQLNSGTFHEWTSSSNMVEREVEVHLPRF 289
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGS 119
+           K+E KY L S+L +LG+TDLF    A+L+G+SS + L +S+A+H +++++SE+G E A +
+Sbjct: 290 KLEIKYELNSLLKSLGVTDLFNQVKADLSGMSSTKGLYLSKAIHKSYLDVSEEGTEAAAA 349
+
+Query: 120 TGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           TG    +K  P   QF+A+HPFLF I+H  TNTI++ G+  SP
+Sbjct: 350 TGDSIAVKSLPMRAQFKANHPFLFFIRHTHTNTILFCGKLASP 392
+
+
+>ref|XP_001056957.1| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B, member 8 [Rattus norvegicus]
+          Length = 375
+
+ Score =  149 bits (376), Expect = 5e-035
+ Identities = 71/161 (44%), Positives = 113/161 (70%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           ++L LP+A  +LSM+VLLPDE SDL  +EK + +EKL  WTNP T+ + +V+V+ P++K+
+Sbjct: 215 QVLALPYAEDELSMVVLLPDESSDLTVVEKALTYEKLRAWTNPETLTESKVQVFFPRLKL 274
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y+L +VL +LGMTD F  + A+ +G++S +++ +S+  H  F+E++E+G E A +T
+Sbjct: 275 EESYDLETVLQSLGMTDAFEETKADFSGMTSKKNVPVSKVAHKCFVEVNEEGTEAAATTA 334
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           VI + +      +F AD PFLF I H  T++I++ GR+ SP
+Sbjct: 335 VIRNTRSCRIEPRFCADRPFLFFIWHQKTSSILFCGRFSSP 375
+
+
+>ref|XP_222490.4| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B, member 8 [Rattus norvegicus]
+          Length = 382
+
+ Score =  149 bits (376), Expect = 5e-035
+ Identities = 71/161 (44%), Positives = 113/161 (70%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           ++L LP+A  +LSM+VLLPDE SDL  +EK + +EKL  WTNP T+ + +V+V+ P++K+
+Sbjct: 222 QVLALPYAEDELSMVVLLPDESSDLTVVEKALTYEKLRAWTNPETLTESKVQVFFPRLKL 281
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y+L +VL +LGMTD F  + A+ +G++S +++ +S+  H  F+E++E+G E A +T
+Sbjct: 282 EESYDLETVLQSLGMTDAFEETKADFSGMTSKKNVPVSKVAHKCFVEVNEEGTEAAATTA 341
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           VI + +      +F AD PFLF I H  T++I++ GR+ SP
+Sbjct: 342 VIRNTRSCRIEPRFCADRPFLFFIWHQKTSSILFCGRFSSP 382
+
+
+>ref|XP_545313.2| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B (ovalbumin), member 1 [Canis familiaris]
+          Length = 382
+
+ Score =  149 bits (376), Expect = 5e-035
+ Identities = 74/166 (44%), Positives = 107/166 (64%), Gaps = 4/166 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K ++LELP+   +LSML+LLPD++ D    L++IE+ +  EKL EWT    +++  V VY
+Sbjct: 217 KCRVLELPYRGRELSMLILLPDDIEDESTGLKKIEEHLTLEKLHEWTKAENLDRVEVNVY 276
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEM 116
+           LP+ K+EE Y L S L  LG+ DLF   A+L+G+S    L IS+ VH +F+E++E+G E
+Sbjct: 277 LPKFKLEESYELNSHLAHLGVQDLFTGRADLSGMSGVRDLFISKIVHKSFVEVNEEGTEA 336
+
+Query: 117 AGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           A +T  I         E F ADHPF+F I+HNP++ I++ GR  SP
+Sbjct: 337 AAATAGIATFAMMMHEENFVADHPFIFFIRHNPSSNILFLGRLCSP 382
+
+
+>ref|XP_001147820.1| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 4 isoform 2 [Pan troglodytes]
+          Length = 369
+
+ Score =  149 bits (375), Expect = 6e-035
+ Identities = 68/161 (42%), Positives = 112/161 (69%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K+LE+P+   DLSM+VLLP+E+  L+++E+ +  EKL EWT+   M +  V ++LP+ K+
+Sbjct: 209 KVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETHVDLHLPRFKM 268
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM ++F   A+L+G++ +  L +S+ +H AF+E++E+G E A +T V
+Sbjct: 269 EESYDLKDTLRTMGMVNIFNGDADLSGMTGSRGLSVSKVLHKAFVEVTEEGAEAAAATAV 328
+
+Query: 123 IEDIKHSPE-SEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +     SP  +E+FR +HPFLF I+ N TN+I+++GR+ SP
+Sbjct: 329 VVVELSSPSTNEEFRCNHPFLFFIRQNKTNSILFYGRFSSP 369
+
+
+>ref|XP_001147882.1| PREDICTED: similar to leupin precursor - human isoform 3 [Pan
+           troglodytes]
+          Length = 390
+
+ Score =  149 bits (375), Expect = 6e-035
+ Identities = 68/161 (42%), Positives = 112/161 (69%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K+LE+P+   DLSM+VLLP+E+  L+++E+ +  EKL EWT+   M +  V ++LP+ K+
+Sbjct: 230 KVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETHVDLHLPRFKM 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM ++F   A+L+G++ +  L +S+ +H AF+E++E+G E A +T V
+Sbjct: 290 EESYDLKDTLRTMGMVNIFNGDADLSGMTGSRGLSVSKVLHKAFVEVTEEGAEAAAATAV 349
+
+Query: 123 IEDIKHSPE-SEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +     SP  +E+FR +HPFLF I+ N TN+I+++GR+ SP
+Sbjct: 350 VVVELSSPSTNEEFRCNHPFLFFIRQNKTNSILFYGRFSSP 390
+
+
+>ref|XP_001090897.1| PREDICTED: serpin peptidase inhibitor, clade B (ovalbumin), member
+           3 isoform 1 [Macaca mulatta]
+          Length = 369
+
+ Score =  149 bits (375), Expect = 6e-035
+ Identities = 70/162 (43%), Positives = 112/162 (69%), Gaps = 3/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K+LE+P+   DLSM+VLLP+E++ L+++E+ +  EKL EWT+   M +  V ++LP+ K+
+Sbjct: 209 KVLEIPYKGKDLSMIVLLPNEINGLQKLEEKLTAEKLLEWTSLQNMREAHVDLHLPRFKV 268
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM DLF   A+L+G++ +  L +S+ +H AF+E++E+G E A +T V
+Sbjct: 269 EESYDLKDTLRNMGMVDLFNGDADLSGMTGSRGLMVSKVLHKAFVEVTEEGAEAAAATAV 328
+
+Query: 123 IEDIKHSP--ESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +     SP   +E+F  +HPFLF I+ N TN+I++FGR+ SP
+Sbjct: 329 VTGFS-SPLLTNEEFHCNHPFLFFIRQNKTNSILFFGRFSSP 369
+
+
+>ref|XP_001091135.1| PREDICTED: serpin peptidase inhibitor, clade B (ovalbumin), member
+           3 isoform 3 [Macaca mulatta]
+          Length = 389
+
+ Score =  149 bits (375), Expect = 6e-035
+ Identities = 70/162 (43%), Positives = 112/162 (69%), Gaps = 3/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K+LE+P+   DLSM+VLLP+E++ L+++E+ +  EKL EWT+   M +  V ++LP+ K+
+Sbjct: 229 KVLEIPYKGKDLSMIVLLPNEINGLQKLEEKLTAEKLLEWTSLQNMREAHVDLHLPRFKV 288
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM DLF   A+L+G++ +  L +S+ +H AF+E++E+G E A +T V
+Sbjct: 289 EESYDLKDTLRNMGMVDLFNGDADLSGMTGSRGLMVSKVLHKAFVEVTEEGAEAAAATAV 348
+
+Query: 123 IEDIKHSP--ESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +     SP   +E+F  +HPFLF I+ N TN+I++FGR+ SP
+Sbjct: 349 VTGFS-SPLLTNEEFHCNHPFLFFIRQNKTNSILFFGRFSSP 389
+
+
+>ref|XP_001091267.1| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 3 isoform 4 [Macaca mulatta]
+          Length = 390
+
+ Score =  149 bits (375), Expect = 6e-035
+ Identities = 70/162 (43%), Positives = 112/162 (69%), Gaps = 3/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K+LE+P+   DLSM+VLLP+E++ L+++E+ +  EKL EWT+   M +  V ++LP+ K+
+Sbjct: 230 KVLEIPYKGKDLSMIVLLPNEINGLQKLEEKLTAEKLLEWTSLQNMREAHVDLHLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM DLF   A+L+G++ +  L +S+ +H AF+E++E+G E A +T V
+Sbjct: 290 EESYDLKDTLRNMGMVDLFNGDADLSGMTGSRGLMVSKVLHKAFVEVTEEGAEAAAATAV 349
+
+Query: 123 IEDIKHSP--ESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +     SP   +E+F  +HPFLF I+ N TN+I++FGR+ SP
+Sbjct: 350 VTGFS-SPLLTNEEFHCNHPFLFFIRQNKTNSILFFGRFSSP 390
+
+
+>gb|AAV73919.1| SERPINB3 [Papio papio]
+          Length = 379
+
+ Score =  148 bits (374), Expect = 8e-035
+ Identities = 70/162 (43%), Positives = 112/162 (69%), Gaps = 3/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K+LE+P+   DLSM+VLLP+E++ L+++E+ +  EKL EWT+   M +  V ++LP+ K+
+Sbjct: 219 KVLEIPYKGKDLSMIVLLPNEINGLQKLEEKLTAEKLLEWTSLQNMREAHVDLHLPRFKV 278
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM DLF   A+L+G++ +  L +S+ +H AF+E++E+G E A +T V
+Sbjct: 279 EESYDLKDTLRNMGMVDLFNGDADLSGMTGSHGLTVSKVLHKAFVEVTEEGAEAAAATAV 338
+
+Query: 123 IEDIKHSP--ESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +     SP   +E+F  +HPFLF I+ N TN+I++FGR+ SP
+Sbjct: 339 VTGFT-SPLLTNEEFHCNHPFLFFIRQNKTNSILFFGRFSSP 379
+
+
+>ref|NP_001030364.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 8 [Bos taurus]
+ sp|Q5BIR5|SPB8_BOVIN Serpin B8
+ gb|AAX31341.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 8 [Bos taurus]
+          Length = 374
+
+ Score =  148 bits (374), Expect = 8e-035
+ Identities = 68/161 (42%), Positives = 113/161 (70%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           ++LELP+   +LSML+LLPDE +DL  +EK + +EK   WT+P  + + +V+V+LP++K+
+Sbjct: 214 QVLELPYVGAELSMLILLPDENTDLAVVEKALTYEKFRTWTSPEKLTEEKVQVFLPRLKL 273
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           E  Y+L + L +LGMTD F  + A+ +G+S+ +++ +S+  H  F+E++E+G E AG+T
+Sbjct: 274 EASYDLEAFLRSLGMTDAFEEAKADFSGMSAKKNVPMSKVAHKCFVEVNEEGTEAAGATA 333
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V+ + +      +F ADHPFLF I+H  TN+I++ GR+ SP
+Sbjct: 334 VVRNSRCCRMEPKFCADHPFLFFIRHRETNSILFCGRFSSP 374
+
+
+>ref|XP_001254790.1| PREDICTED: similar to SCCA2/SCCA1 fusion protein [Bos taurus]
+          Length = 390
+
+ Score =  148 bits (373), Expect = 1e-034
+ Identities = 75/161 (46%), Positives = 103/161 (63%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KILE+P+   +LSM+VLLPDEV  L+ +E  +  EKL  W +P  M KR+V +YLP+ K+
+Sbjct: 230 KILEIPYKGSELSMMVLLPDEVDGLQELEDQLTAEKLIAWMSPQNMRKRQVDLYLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y+L   L ALGM D F    A+ +G++    L +S+  H  F+E++E+G E A +TG
+Sbjct: 290 EESYDLVPTLQALGMVDAFRDGVADFSGMTGGRDLVVSKVFHKCFVEVTEEGTEAAAATG 349
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V    +    SE FR D PFLFLIKH  TN+I++ GR  SP
+Sbjct: 350 VEIIERAGRNSESFRCDRPFLFLIKHIKTNSILFCGRVSSP 390
+
+
+>ref|XP_001254559.1| PREDICTED: similar to SCCA2/SCCA1 fusion protein [Bos taurus]
+          Length = 390
+
+ Score =  148 bits (373), Expect = 1e-034
+ Identities = 75/161 (46%), Positives = 103/161 (63%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KILE+P+   +LSM+VLLPDEV  L+ +E  +  EKL  W +P  M KR+V +YLP+ K+
+Sbjct: 230 KILEIPYKGSELSMMVLLPDEVDGLQELEDQLTAEKLIAWMSPQNMRKRQVDLYLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y+L   L ALGM D F    A+ +G++    L +S+  H  F+E++E+G E A +TG
+Sbjct: 290 EESYDLVPTLQALGMVDAFRDGVADFSGMTGGRDLVVSKVFHKCFVEVTEEGTEAAAATG 349
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V    +    SE FR D PFLFLIKH  TN+I++ GR  SP
+Sbjct: 350 VEIIERAGRNSESFRCDRPFLFLIKHIKTNSILFCGRVSSP 390
+
+
+>ref|XP_869744.2| PREDICTED: similar to bomapin isoform 2 [Bos taurus]
+          Length = 397
+
+ Score =  148 bits (373), Expect = 1e-034
+ Identities = 73/159 (45%), Positives = 110/159 (69%), Gaps = 1/159 (0%)
+
+Query: 5   LELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEE 64
+           L+L + S DLS+L+LLP++V  L+++EKTI +EKL+EWT+ + ME   V++ LP+ K+EE
+Sbjct: 239 LQLYYESRDLSLLILLPEDVDGLDQLEKTITYEKLSEWTSADMMELCNVQLNLPKFKLEE 298
+
+Query: 65  KYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVI 123
+            Y+L S L ++GM+D F  S A+ +G+SS  +L +S   H  F+E++E G E A  TG
+Sbjct: 299 TYDLKSTLSSMGMSDAFNQSKADFSGMSSERNLFLSNVFHKCFVEINEQGTEAAAGTGSE 358
+
+Query: 124 EDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+             ++    S +F ADHPFLF I+HN TN I+++GR+ SP
+Sbjct: 359 VSVRMKLPSIEFNADHPFLFFIRHNKTNGILFYGRFCSP 397
+
+
+>ref|XP_001232329.1| PREDICTED: similar to Leukocyte elastase inhibitor (LEI) (Serpin
+           B1) (Monocyte/neutrophil elastase inhibitor) (M/NEI)
+           (EI) isoform 1 [Gallus gallus]
+          Length = 378
+
+ Score =  148 bits (373), Expect = 1e-034
+ Identities = 76/167 (45%), Positives = 112/167 (67%), Gaps = 6/167 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K ++LELP+   + SM++LLPD++ D    L+++E+ +  EKL EWT P  +    V V+
+Sbjct: 213 KTRVLELPYDEREFSMIILLPDDIEDDSTGLQKLEQQLTLEKLQEWTRPEHLYSTDVHVH 272
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ K+EE Y+L S L A+G+ D+F    A+L+G+S A  L +S+ VH AF+E++E+G E
+Sbjct: 273 LPKFKLEESYDLKSDLSAMGLLDIFDSAKADLSGMSGAHDLFLSKIVHKAFVEVNEEGTE 332
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +T  I  +    E E F ADHPFLF ++HNPT +IV+FGRY SP
+Sbjct: 333 AAAATAGIAMLCMVIE-EDFNADHPFLFFLRHNPTKSIVFFGRYASP 378
+
+
+>ref|XP_001092672.1| PREDICTED: serpin peptidase inhibitor, clade B (ovalbumin), member
+           6 isoform 3 [Macaca mulatta]
+          Length = 378
+
+ Score =  148 bits (373), Expect = 1e-034
+ Identities = 72/164 (43%), Positives = 114/164 (69%), Gaps = 7/164 (4%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +IL LP+   +L+M+++LPDE +DLE +EK +++E+  EWTNP+ M +R ++V+LP+ K+
+Sbjct: 218 EILVLPYVGKELNMIIMLPDENTDLETVEKELSYERFIEWTNPDKMHEREMEVFLPRFKL 277
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE YN+  VL ++GM D F    A+ TG+SS + L +S+  H +F+E++E+G E A +T
+Sbjct: 278 EETYNMEDVLRSMGMVDAFEQDRADFTGMSSKKDLYLSKVTHKSFVEVNEEGTEAAAATA 337
+
+Query: 122 ---VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+              V++  +  P    FRADHPFLF I+H+ TN I++ GR+ SP
+Sbjct: 338 CRIVLQGFRIIP---TFRADHPFLFFIQHSKTNGILFCGRFSSP 378
+
+
+>ref|XP_001092443.1| PREDICTED: serpin peptidase inhibitor, clade B (ovalbumin), member
+           6 isoform 1 [Macaca mulatta]
+          Length = 358
+
+ Score =  148 bits (373), Expect = 1e-034
+ Identities = 72/164 (43%), Positives = 114/164 (69%), Gaps = 7/164 (4%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +IL LP+   +L+M+++LPDE +DLE +EK +++E+  EWTNP+ M +R ++V+LP+ K+
+Sbjct: 198 EILVLPYVGKELNMIIMLPDENTDLETVEKELSYERFIEWTNPDKMHEREMEVFLPRFKL 257
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE YN+  VL ++GM D F    A+ TG+SS + L +S+  H +F+E++E+G E A +T
+Sbjct: 258 EETYNMEDVLRSMGMVDAFEQDRADFTGMSSKKDLYLSKVTHKSFVEVNEEGTEAAAATA 317
+
+Query: 122 ---VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+              V++  +  P    FRADHPFLF I+H+ TN I++ GR+ SP
+Sbjct: 318 CRIVLQGFRIIP---TFRADHPFLFFIQHSKTNGILFCGRFSSP 358
+
+
+>ref|NP_001006377.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 6 [Gallus gallus]
+ emb|CAG31477.1| hypothetical protein [Gallus gallus]
+          Length = 379
+
+ Score =  148 bits (373), Expect = 1e-034
+ Identities = 72/165 (43%), Positives = 110/165 (66%), Gaps = 5/165 (3%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVYLP 58
+           KILE+P+   +LSM+VLLPD + D    LE++E+ + +EKL +W NP  M+   V++ LP
+Sbjct: 215 KILEIPYIGNELSMIVLLPDAIQDESTGLEKLERELTYEKLMDWINPEMMDSTEVRLSLP 274
+
+Query: 59  QMKIEEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIEMA 117
+           + K+EE Y+L  +L  +GM D F +  AN +GISS   L +S+ VH +F+E++E+G E A
+Sbjct: 275 RFKLEENYDLKPILSNMGMRDAFDLRMANFSGISSGNELVLSEVVHKSFVEVNEEGTEAA 334
+
+Query: 118 GSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            +T  +  ++ +     F ADHPFLF I+HN T++I++ GRY SP
+Sbjct: 335 AATAGVMVLRCAMIVPDFTADHPFLFFIRHNKTSSILFCGRYCSP 379
+
+
+>ref|XP_418980.1| PREDICTED: similar to Leukocyte elastase inhibitor (LEI) (Serpin
+           B1) (Monocyte/neutrophil elastase inhibitor) (M/NEI)
+           (EI) isoform 2 [Gallus gallus]
+          Length = 378
+
+ Score =  148 bits (373), Expect = 1e-034
+ Identities = 76/167 (45%), Positives = 112/167 (67%), Gaps = 6/167 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K ++LELP+   + SM++LLPD++ D    L+++E+ +  EKL EWT P  +    V V+
+Sbjct: 213 KTRVLELPYDEREFSMIILLPDDIEDDSTGLQKLEQQLTLEKLQEWTRPEHLYSTDVHVH 272
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ K+EE Y+L S L A+G+ D+F    A+L+G+S A  L +S+ VH AF+E++E+G E
+Sbjct: 273 LPKFKLEESYDLKSDLSAMGLLDIFDSAKADLSGMSGAHDLFLSKIVHKAFVEVNEEGTE 332
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +T  I  +    E E F ADHPFLF ++HNPT +IV+FGRY SP
+Sbjct: 333 AAAATAGIAMLCMVIE-EDFNADHPFLFFLRHNPTKSIVFFGRYASP 378
+
+
+>ref|NP_001075416.1| serpin [Equus caballus]
+ sp|P05619|ILEU_HORSE Leukocyte elastase inhibitor (LEI) (Serpin B1)
+ gb|AAA97513.1| serpin
+ gb|AAB21885.1| elastase inhibitor=plasminogen activator inhibitor-2 homolog
+           [horses, leukocyte, Peptide, 379 aa]
+          Length = 379
+
+ Score =  148 bits (373), Expect = 1e-034
+ Identities = 78/168 (46%), Positives = 112/168 (66%), Gaps = 7/168 (4%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K ++LELP+   +LSM++LLPD++ D    LE+IEK +  EKL EWT P  +    V V+
+Sbjct: 213 KCRVLELPYQGKELSMIILLPDDIEDESTGLEKIEKQLTLEKLREWTKPENLYLAEVNVH 272
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ K+EE Y+LTS L  LG+ DLF    A+L+G+S A  L +S+ +H +F++L+E+G E
+Sbjct: 273 LPRFKLEESYDLTSHLARLGVQDLFNRGKADLSGMSGARDLFVSKIIHKSFVDLNEEGTE 332
+
+Query: 116 MAGST-GVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +T G I      PE E F ADHPF+F I+HNP+  I++ GR+ SP
+Sbjct: 333 AAAATAGTIMLAMLMPE-ENFNADHPFIFFIRHNPSANILFLGRFSSP 379
+
+
+>gb|EAW63158.1| serpin peptidase inhibitor, clade B (ovalbumin), member 11 [Homo
+           sapiens]
+          Length = 278
+
+ Score =  147 bits (372), Expect = 1e-034
+ Identities = 72/163 (44%), Positives = 115/163 (70%), Gaps = 1/163 (0%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           +M++LELP+ +  LSM++LLP  +++L++IEK +N     EWT+ + M +R V+V+LP+
+Sbjct: 116 QMQVLELPYVNNKLSMIILLPVGIANLKQIEKQLNSGTFHEWTSSSNMMEREVEVHLPRF 175
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGS 119
+           K+E KY L S+L  LG+TDLF    A+L+G+S  + L +S+A+H +++++SE+G E A +
+Sbjct: 176 KLEIKYELNSLLKPLGVTDLFNQVKADLSGMSPTKGLYLSKAIHKSYLDVSEEGTEAAAA 235
+
+Query: 120 TGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           TG    +K  P   QF+A+HPFLF I+H  TNTI++ G+  SP
+Sbjct: 236 TGDSIAVKSLPMRAQFKANHPFLFFIRHTHTNTILFCGKLASP 278
+
+
+>gb|AAV73920.1| SERPINB11d [Homo sapiens]
+          Length = 392
+
+ Score =  147 bits (372), Expect = 1e-034
+ Identities = 72/163 (44%), Positives = 115/163 (70%), Gaps = 1/163 (0%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           +M++LELP+ +  LSM++LLP  +++L++IEK +N     EWT+ + M +R V+V+LP+
+Sbjct: 230 QMQVLELPYVNNKLSMIILLPVGIANLKQIEKQLNSGAFHEWTSSSNMMEREVEVHLPRF 289
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGS 119
+           K+E KY L S+L  LG+TDLF    A+L+G+S  + L +S+A+H +++++SE+G E A +
+Sbjct: 290 KLEIKYELNSLLKPLGVTDLFNQVKADLSGMSPTKGLYLSKAIHKSYLDVSEEGTEAAAA 349
+
+Query: 120 TGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           TG    +K  P   QF+A+HPFLF I+H  TNTI++ G+  SP
+Sbjct: 350 TGDSIAVKSLPMRAQFKANHPFLFFIRHTHTNTILFCGKLASP 392
+
+
+>gb|AAQ04770.1|AF461146_1 SCCA2/SCCA1 fusion protein isoform 1 [Homo sapiens]
+          Length = 390
+
+ Score =  147 bits (372), Expect = 1e-034
+ Identities = 70/162 (43%), Positives = 111/162 (68%), Gaps = 3/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K+LE+P+   DLSM+VLLP+E+  L+++E+ +  EKL EWT+   M + RV ++LP+ K+
+Sbjct: 230 KVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM D+F   A+L+G++ +  L +S  +H AF+E++E+G E A +T V
+Sbjct: 290 EESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAV 349
+
+Query: 123 IEDIKHSPES--EQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +     SP S  E+F  +HPFLF I+ N TN+I+++GR+ SP
+Sbjct: 350 V-GFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP 390
+
+
+>ref|NP_536723.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 11 [Homo sapiens]
+ gb|AAL16058.1|AF419955_1 serine proteinase inhibitor SERPINB11 [Homo sapiens]
+ gb|AAH69596.1| Serpin peptidase inhibitor, clade B (ovalbumin), member 11 [Homo
+           sapiens]
+          Length = 392
+
+ Score =  147 bits (372), Expect = 1e-034
+ Identities = 72/163 (44%), Positives = 115/163 (70%), Gaps = 1/163 (0%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           +M++LELP+ +  LSM++LLP  +++L++IEK +N     EWT+ + M +R V+V+LP+
+Sbjct: 230 QMQVLELPYVNNKLSMIILLPVGIANLKQIEKQLNSGTFHEWTSSSNMMEREVEVHLPRF 289
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGS 119
+           K+E KY L S+L  LG+TDLF    A+L+G+S  + L +S+A+H +++++SE+G E A +
+Sbjct: 290 KLEIKYELNSLLKPLGVTDLFNQVKADLSGMSPTKGLYLSKAIHKSYLDVSEEGTEAAAA 349
+
+Query: 120 TGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           TG    +K  P   QF+A+HPFLF I+H  TNTI++ G+  SP
+Sbjct: 350 TGDSIAVKSLPMRAQFKANHPFLFFIRHTHTNTILFCGKLASP 392
+
+
+>emb|CAD56658.1| squamous cell carcinoma antigen 1 [Homo sapiens]
+          Length = 390
+
+ Score =  147 bits (372), Expect = 1e-034
+ Identities = 70/162 (43%), Positives = 111/162 (68%), Gaps = 3/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K+LE+P+   DLSM+VLLP+E+  L+++E+ +  EKL EWT+   M + RV ++LP+ K+
+Sbjct: 230 KVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM D+F   A+L+G++ +  L +S  +H AF+E++E+G E A +T V
+Sbjct: 290 EESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAV 349
+
+Query: 123 IEDIKHSPES--EQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +     SP S  E+F  +HPFLF I+ N TN+I+++GR+ SP
+Sbjct: 350 VA-FGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP 390
+
+
+>gb|AAP36625.1| Homo sapiens serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 3 [synthetic construct]
+ gb|AAX29443.1| serine or cysteine proteinase inhibitor clade B member 3 [synthetic
+           construct]
+          Length = 391
+
+ Score =  147 bits (372), Expect = 1e-034
+ Identities = 70/162 (43%), Positives = 111/162 (68%), Gaps = 3/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K+LE+P+   DLSM+VLLP+E+  L+++E+ +  EKL EWT+   M + RV ++LP+ K+
+Sbjct: 230 KVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM D+F   A+L+G++ +  L +S  +H AF+E++E+G E A +T V
+Sbjct: 290 EESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAV 349
+
+Query: 123 IEDIKHSPES--EQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +     SP S  E+F  +HPFLF I+ N TN+I+++GR+ SP
+Sbjct: 350 V-GFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP 390
+
+
+>gb|AAO11731.1| SCCA-PD variant; squamous cell carcinoma antigen [Homo sapiens]
+          Length = 179
+
+ Score =  147 bits (372), Expect = 1e-034
+ Identities = 70/162 (43%), Positives = 111/162 (68%), Gaps = 3/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K+LE+P+   DLSM+VLLP+E+  L+++E+ +  EKL EWT+   M + RV ++LP+ K+
+Sbjct: 19  KVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKV 78
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM D+F   A+L+G++ +  L +S  +H AF+E++E+G E A +T V
+Sbjct: 79  EESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAV 138
+
+Query: 123 IEDIKHSPES--EQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +     SP S  E+F  +HPFLF I+ N TN+I+++GR+ SP
+Sbjct: 139 VA-FGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP 179
+
+
+>gb|AAL16057.1|AF419954_1 serine proteinase inhibitor SERPINB11 [Homo sapiens]
+          Length = 392
+
+ Score =  147 bits (372), Expect = 1e-034
+ Identities = 72/163 (44%), Positives = 115/163 (70%), Gaps = 1/163 (0%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           +M++LELP+ +  LSM++LLP  +++L++IEK +N     EWT+ + M +R V+V+LP+
+Sbjct: 230 QMQVLELPYVNNKLSMIILLPVGIANLKQIEKQLNSGTFHEWTSSSNMMEREVEVHLPRF 289
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGS 119
+           K+E KY L S+L  LG+TDLF    A+L+G+S  + L +S+A+H +++++SE+G E A +
+Sbjct: 290 KLEIKYELNSLLKPLGVTDLFNQVKADLSGMSPTKGLYLSKAIHKSYLDVSEEGTEAAAA 349
+
+Query: 120 TGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           TG    +K  P   QF+A+HPFLF I+H  TNTI++ G+  SP
+Sbjct: 350 TGDSIAVKSLPMRAQFKANHPFLFFIRHTHTNTILFCGKLASP 392
+
+
+>sp|Q96P15|SPB11_HUMAN Serpin B11
+ gb|AAL16056.1|AF419953_1 serine proteinase inhibitor SERPINB11 [Homo sapiens]
+          Length = 392
+
+ Score =  147 bits (372), Expect = 1e-034
+ Identities = 72/163 (44%), Positives = 115/163 (70%), Gaps = 1/163 (0%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           +M++LELP+ +  LSM++LLP  +++L++IEK +N     EWT+ + M +R V+V+LP+
+Sbjct: 230 QMQVLELPYVNNKLSMIILLPVGIANLKQIEKQLNSGTFHEWTSSSNMMEREVEVHLPRF 289
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGS 119
+           K+E KY L S+L  LG+TDLF    A+L+G+S  + L +S+A+H +++++SE+G E A +
+Sbjct: 290 KLEIKYELNSLLKPLGVTDLFNQVKADLSGMSPTKGLYLSKAIHKSYLDVSEEGTEAAAA 349
+
+Query: 120 TGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           TG    +K  P   QF+A+HPFLF I+H  TNTI++ G+  SP
+Sbjct: 350 TGDSIAVKSLPMRAQFKANHPFLFFIRHTHTNTILFCGKLASP 392
+
+
+>ref|NP_008850.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 3 [Homo sapiens]
+ sp|P29508|SPB3_HUMAN Serpin B3 (Squamous cell carcinoma antigen 1) (SCCA-1) (Protein
+           T4-A)
+ gb|AAA86317.1| squamous cell carcinoma antigen
+ gb|AAA97552.1| squamous cell carcinoma antigen 1
+ gb|AAH05224.1| Serpin peptidase inhibitor, clade B (ovalbumin), member 3 [Homo
+           sapiens]
+ gb|AAP35394.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 3 [Homo sapiens]
+ gb|AAX32840.1| serine or cysteine proteinase inhibitor clade B member 3 [synthetic
+           construct]
+ gb|EAW63156.1| serpin peptidase inhibitor, clade B (ovalbumin), member 3, isoform
+           CRA_a [Homo sapiens]
+ gb|ABM84648.1| serpin peptidase inhibitor, clade B (ovalbumin), member 3
+           [synthetic construct]
+ gb|ABM92177.1| serpin peptidase inhibitor, clade B (ovalbumin), member 3
+           [synthetic construct]
+          Length = 390
+
+ Score =  147 bits (372), Expect = 1e-034
+ Identities = 70/162 (43%), Positives = 111/162 (68%), Gaps = 3/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K+LE+P+   DLSM+VLLP+E+  L+++E+ +  EKL EWT+   M + RV ++LP+ K+
+Sbjct: 230 KVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM D+F   A+L+G++ +  L +S  +H AF+E++E+G E A +T V
+Sbjct: 290 EESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAV 349
+
+Query: 123 IEDIKHSPES--EQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +     SP S  E+F  +HPFLF I+ N TN+I+++GR+ SP
+Sbjct: 350 V-GFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP 390
+
+
+>gb|AAB20405.1| squamous cell carcinoma antigen; SCC antigen [Homo sapiens]
+ dbj|BAD96466.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 3 variant [Homo sapiens]
+ dbj|BAD96473.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 3 variant [Homo sapiens]
+          Length = 390
+
+ Score =  147 bits (372), Expect = 1e-034
+ Identities = 70/162 (43%), Positives = 111/162 (68%), Gaps = 3/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K+LE+P+   DLSM+VLLP+E+  L+++E+ +  EKL EWT+   M + RV ++LP+ K+
+Sbjct: 230 KVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM D+F   A+L+G++ +  L +S  +H AF+E++E+G E A +T V
+Sbjct: 290 EESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAV 349
+
+Query: 123 IEDIKHSPES--EQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +     SP S  E+F  +HPFLF I+ N TN+I+++GR+ SP
+Sbjct: 350 V-GFGSSPASTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP 390
+
+
+>ref|XP_001254685.1| PREDICTED: similar to SCCA2/SCCA1 fusion protein [Bos taurus]
+          Length = 390
+
+ Score =  147 bits (371), Expect = 2e-034
+ Identities = 74/161 (45%), Positives = 105/161 (65%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KILE+P+   +LSM+VLLPDEV  L+ +E  +  EKL  WT+P  M KR+V +YLP+ K+
+Sbjct: 230 KILEIPYKGSELSMMVLLPDEVDGLQELEDQLTAEKLIAWTSPQNMRKRQVDLYLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y+L   L ALGM D F    A+ +G++    L +S+  H +F+E++E+G E A +T
+Sbjct: 290 EESYDLVPTLQALGMVDAFRDGVADFSGMTGGRDLVVSKVFHKSFVEVTEEGTEAAAATD 349
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V    +    SE FR +HPFLFLIKH  T++I++ GR  SP
+Sbjct: 350 VEIIERAGRNSESFRCNHPFLFLIKHIKTSSILFCGRVSSP 390
+
+
+>ref|XP_001254006.1| PREDICTED: similar to SCCA2/SCCA1 fusion protein [Bos taurus]
+          Length = 390
+
+ Score =  147 bits (371), Expect = 2e-034
+ Identities = 74/161 (45%), Positives = 105/161 (65%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KILE+P+   +LSM+VLLPDEV  L+ +E  +  EKL  WT+P  M KR+V +YLP+ K+
+Sbjct: 230 KILEIPYKGSELSMMVLLPDEVDGLQELEDQLTAEKLIAWTSPQNMRKRQVDLYLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y+L   L ALGM D F    A+ +G++    L +S+  H +F+E++E+G E A +T
+Sbjct: 290 EESYDLVPTLQALGMVDAFRDGVADFSGMTGGRDLVVSKVFHKSFVEVTEEGTEAAAATD 349
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V    +    SE FR +HPFLFLIKH  T++I++ GR  SP
+Sbjct: 350 VEIIERAGRNSESFRCNHPFLFLIKHIKTSSILFCGRVSSP 390
+
+
+>gb|AAV73921.1| SERPINB11e [Homo sapiens]
+          Length = 305
+
+ Score =  146 bits (368), Expect = 4e-034
+ Identities = 72/163 (44%), Positives = 114/163 (69%), Gaps = 1/163 (0%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           +M++LELP+ +  LSM++LLP  +++L++IEK +N     EWT+ + M +R V+V+LP+
+Sbjct: 143 QMQVLELPYVNNKLSMIILLPVGIANLKQIEKQLNSGTFHEWTSSSNMMEREVEVHLPRF 202
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGS 119
+           K+E KY L S+L  LG+TDLF    A+L+G+S  + L +S+A+H +++++SE+G E A +
+Sbjct: 203 KLEIKYELNSLLKPLGVTDLFNQVKADLSGMSPTKGLYLSKAIHKSYLDVSEEGTEAAAA 262
+
+Query: 120 TGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           TG     K  P   QF+A+HPFLF I+H  TNTI++ G+  SP
+Sbjct: 263 TGDSIAAKSLPMRAQFKANHPFLFFIRHTHTNTILFCGKLASP 305
+
+
+>ref|NP_033280.1| serine (or cysteine) proteinase inhibitor, clade B, member 6a [Mus
+           musculus]
+ sp|Q60854|SPB6_MOUSE Serpin B6 (Placental thrombin inhibitor) (Protease inhibitor 6)
+           (PI-6)
+ gb|AAA79684.1| SPI3 [Mus musculus]
+ gb|AAH06766.1| Serine (or cysteine) peptidase inhibitor, clade B, member 6a [Mus
+           musculus]
+ gb|AAH57950.1| Serpinb6a protein [Mus musculus]
+ emb|CAI24781.1| serine (or cysteine) proteinase inhibitor, clade B, member 6 [Mus
+           musculus]
+ emb|CAJ18554.1| Serpinb6a [Mus musculus]
+ dbj|BAE40924.1| unnamed protein product [Mus musculus]
+ dbj|BAE39400.1| unnamed protein product [Mus musculus]
+          Length = 378
+
+ Score =  146 bits (368), Expect = 4e-034
+ Identities = 70/160 (43%), Positives = 107/160 (66%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KIL LP+ S +L+M+++LPDE  +L  +EK + +EK  EWT  + M++  V+V+LP+ K+
+Sbjct: 219 KILLLPYVSSELNMIIMLPDEHVELSTVEKEVTYEKFIEWTRLDKMDEEEVEVFLPKFKL 278
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE YN+   L  LGMTD F   A+ +G+SS + L +S+ VH AF+E++E+G E A +T
+Sbjct: 279 EENYNMNDALYKLGMTDAFGGRADFSGMSSKQGLFLSKVVHKAFVEVNEEGTEAAAATAG 338
+
+Query: 123 IEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +  ++    + +F ADHPFLF I H  TN I++ GR+ SP
+Sbjct: 339 MMTVRCMRFTPRFCADHPFLFFIHHVKTNGILFCGRFSSP 378
+
+
+>ref|XP_001250999.1| PREDICTED: similar to SCCA2/SCCA1 fusion protein isoform 2 [Bos
+           taurus]
+          Length = 395
+
+ Score =  145 bits (367), Expect = 5e-034
+ Identities = 78/166 (46%), Positives = 106/166 (63%), Gaps = 6/166 (3%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLER----IEKTINFEKLTEWTNPNTMEKRRVKVYLP 58
+           KILE+P+   +LSM+VLLP+EV D+      +E  +  EKL  WT+P  M KR V +YLP
+Sbjct: 230 KILEIPYKGEELSMMVLLPNEVDDISTYVYILEDQLTAEKLIAWTSPQNMGKREVDLYLP 289
+
+Query: 59  QMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMA 117
+           + K+EE Y+L   L ALGM D F    AN +G++    L +S+  H +F+E++E+G E A
+Sbjct: 290 RFKVEESYDLVPTLKALGMVDAFNDKVANFSGMTGRRDLVVSKVFHKSFVEVTEEGTEAA 349
+
+Query: 118 GSTGV-IEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            +TGV +  I   P  E FR DHPFLFLIKH  TN+I++ GR  SP
+Sbjct: 350 AATGVGVAVITSLPIRESFRCDHPFLFLIKHIKTNSILFGGRVSSP 395
+
+
+>ref|XP_001147517.1| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 13 isoform 4 [Pan troglodytes]
+          Length = 413
+
+ Score =  145 bits (367), Expect = 5e-034
+ Identities = 70/161 (43%), Positives = 109/161 (67%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KIL +P+ + DLSM VLLP+++  LE+I   I+ EKL EWT+P  ME+RRV ++LP+ ++
+Sbjct: 253 KILGIPYKNNDLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERRVNLHLPRFEV 312
+
+Query: 63  EEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           E+ Y+L +VL A+GM D F    A+ +G+SS   L     +H +F+ ++E+G E A +TG
+Sbjct: 313 EDSYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQTFLHSSFVAVTEEGTEAAAATG 372
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +   +  +P  E    +HPFLF I+HN +N+I++FGR+ SP
+Sbjct: 373 IGFTVTSAPGHENVHCNHPFLFFIRHNESNSILFFGRFSSP 413
+
+
+>ref|XP_001147442.1| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 13 isoform 3 [Pan troglodytes]
+          Length = 391
+
+ Score =  145 bits (367), Expect = 5e-034
+ Identities = 70/161 (43%), Positives = 109/161 (67%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KIL +P+ + DLSM VLLP+++  LE+I   I+ EKL EWT+P  ME+RRV ++LP+ ++
+Sbjct: 231 KILGIPYKNNDLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERRVNLHLPRFEV 290
+
+Query: 63  EEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           E+ Y+L +VL A+GM D F    A+ +G+SS   L     +H +F+ ++E+G E A +TG
+Sbjct: 291 EDSYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQTFLHSSFVAVTEEGTEAAAATG 350
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +   +  +P  E    +HPFLF I+HN +N+I++FGR+ SP
+Sbjct: 351 IGFTVTSAPGHENVHCNHPFLFFIRHNESNSILFFGRFSSP 391
+
+
+>ref|XP_001147213.1| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 13 isoform 1 [Pan troglodytes]
+          Length = 391
+
+ Score =  145 bits (367), Expect = 5e-034
+ Identities = 70/161 (43%), Positives = 109/161 (67%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KIL +P+ + DLSM VLLP+++  LE+I   I+ EKL EWT+P  ME+RRV ++LP+ ++
+Sbjct: 231 KILGIPYKNNDLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERRVNLHLPRFEV 290
+
+Query: 63  EEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           E+ Y+L +VL A+GM D F    A+ +G+SS   L     +H +F+ ++E+G E A +TG
+Sbjct: 291 EDSYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQTFLHSSFVAVTEEGTEAAAATG 350
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +   +  +P  E    +HPFLF I+HN +N+I++FGR+ SP
+Sbjct: 351 IGFTVTSAPGHENVHCNHPFLFFIRHNESNSILFFGRFSSP 391
+
+
+>emb|CAI25648.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 1a [Mus musculus]
+          Length = 348
+
+ Score =  145 bits (367), Expect = 5e-034
+ Identities = 77/167 (46%), Positives = 108/167 (64%), Gaps = 5/167 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K K+LE+P+  G+LSM++LLP ++ D    L++IEK I  EKL EWT    +E   V V
+Sbjct: 182 KCKVLEMPYQGGELSMVILLPKDIEDESTGLKKIEKQITLEKLLEWTKRENLEFIDVHVK 241
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ KIEE Y L S L  LG+ DLF  S A+L+G+S +  L IS+ VH +F+E++E+G E
+Sbjct: 242 LPRFKIEESYTLNSNLGRLGVQDLFSSSKADLSGMSGSRDLFISKIVHKSFVEVNEEGTE 301
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +TG I         E+F  DHPF+F I+HNPT+ +++ GR  SP
+Sbjct: 302 AAAATGGIATFCMLLPEEEFTVDHPFIFFIRHNPTSNVLFLGRVCSP 348
+
+
+>ref|NP_079705.2| serine (or cysteine) proteinase inhibitor, clade B, member 1a [Mus
+           musculus]
+ gb|AAL57486.1|AF426024_1 EIA [Mus musculus]
+ dbj|BAB23079.1| unnamed protein product [Mus musculus]
+ gb|AAH11140.1| Serine (or cysteine) peptidase inhibitor, clade B, member 1a [Mus
+           musculus]
+ gb|AAM95933.1| serine protease inhibitor EIA; serpin clade B; ovalbumin-related
+           serpin [Mus musculus]
+ dbj|BAE35668.1| unnamed protein product [Mus musculus]
+ gb|AAI04334.1| Serine (or cysteine) peptidase inhibitor, clade B, member 1a [Mus
+           musculus]
+          Length = 379
+
+ Score =  145 bits (367), Expect = 5e-034
+ Identities = 77/167 (46%), Positives = 108/167 (64%), Gaps = 5/167 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K K+LE+P+  G+LSM++LLP ++ D    L++IEK I  EKL EWT    +E   V V
+Sbjct: 213 KCKVLEMPYQGGELSMVILLPKDIEDESTGLKKIEKQITLEKLLEWTKRENLEFIDVHVK 272
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ KIEE Y L S L  LG+ DLF  S A+L+G+S +  L IS+ VH +F+E++E+G E
+Sbjct: 273 LPRFKIEESYTLNSNLGRLGVQDLFSSSKADLSGMSGSRDLFISKIVHKSFVEVNEEGTE 332
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +TG I         E+F  DHPF+F I+HNPT+ +++ GR  SP
+Sbjct: 333 AAAATGGIATFCMLLPEEEFTVDHPFIFFIRHNPTSNVLFLGRVCSP 379
+
+
+>dbj|BAB25964.1| unnamed protein product [Mus musculus]
+          Length = 379
+
+ Score =  145 bits (367), Expect = 5e-034
+ Identities = 77/167 (46%), Positives = 108/167 (64%), Gaps = 5/167 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K K+LE+P+  G+LSM++LLP ++ D    L++IEK I  EKL EWT    +E   V V
+Sbjct: 213 KCKVLEMPYQGGELSMVILLPKDIEDESTGLKKIEKQITLEKLLEWTKRENLEFIDVHVK 272
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ KIEE Y L S L  LG+ DLF  S A+L+G+S +  L IS+ VH +F+E++E+G E
+Sbjct: 273 LPRFKIEESYTLNSNLGRLGVQDLFSSSKADLSGMSGSRDLFISKIVHKSFVEVNEEGTE 332
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +TG I         E+F  DHPF+F I+HNPT+ +++ GR  SP
+Sbjct: 333 AAAATGGIATFCMLLPEEEFTVDHPFIFFIRHNPTSNVLFLGRVCSP 379
+
+
+>dbj|BAC36206.1| unnamed protein product [Mus musculus]
+          Length = 379
+
+ Score =  145 bits (367), Expect = 5e-034
+ Identities = 77/167 (46%), Positives = 108/167 (64%), Gaps = 5/167 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K K+LE+P+  G+LSM++LLP ++ D    L++IEK I  EKL EWT    +E   V V
+Sbjct: 213 KCKVLEMPYRGGELSMVILLPKDIEDESTGLKKIEKQITLEKLLEWTKRENLEFIDVHVK 272
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ KIEE Y L S L  LG+ DLF  S A+L+G+S +  L IS+ VH +F+E++E+G E
+Sbjct: 273 LPRFKIEESYTLNSNLGRLGVQDLFSSSKADLSGMSGSRDLFISKIVHKSFVEVNEEGTE 332
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +TG I         E+F  DHPF+F I+HNPT+ +++ GR  SP
+Sbjct: 333 AAAATGGIATFCMLLPEEEFTVDHPFIFFIRHNPTSNVLFLGRVCSP 379
+
+
+>gb|EAW63152.1| serpin peptidase inhibitor, clade B (ovalbumin), member 13, isoform
+           CRA_c [Homo sapiens]
+          Length = 408
+
+ Score =  145 bits (366), Expect = 7e-034
+ Identities = 69/161 (42%), Positives = 110/161 (68%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KIL +P+ + DLSM VLLP+++  LE+I   I+ EKL EWT+P  ME+R+V ++LP+ ++
+Sbjct: 248 KILGIPYKNNDLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERKVNLHLPRFEV 307
+
+Query: 63  EEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           E+ Y+L +VL A+GM D F    A+ +G+SS   L   + +H +F+ ++E+G E A +TG
+Sbjct: 308 EDSYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATG 367
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +   +  +P  E    +HPFLF I+HN +N+I++FGR+ SP
+Sbjct: 368 IGFTVTSAPGHENVHCNHPFLFFIRHNESNSILFFGRFSSP 408
+
+
+>gb|EAW63151.1| serpin peptidase inhibitor, clade B (ovalbumin), member 13, isoform
+           CRA_b [Homo sapiens]
+          Length = 255
+
+ Score =  145 bits (366), Expect = 7e-034
+ Identities = 69/161 (42%), Positives = 110/161 (68%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KIL +P+ + DLSM VLLP+++  LE+I   I+ EKL EWT+P  ME+R+V ++LP+ ++
+Sbjct: 95  KILGIPYKNNDLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERKVNLHLPRFEV 154
+
+Query: 63  EEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           E+ Y+L +VL A+GM D F    A+ +G+SS   L   + +H +F+ ++E+G E A +TG
+Sbjct: 155 EDSYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATG 214
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +   +  +P  E    +HPFLF I+HN +N+I++FGR+ SP
+Sbjct: 215 IGFTVTSAPGHENVHCNHPFLFFIRHNESNSILFFGRFSSP 255
+
+
+>gb|AAO92272.1| squamous cell carcinoma antigen 1 [Homo sapiens]
+          Length = 390
+
+ Score =  145 bits (366), Expect = 7e-034
+ Identities = 69/162 (42%), Positives = 110/162 (67%), Gaps = 3/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K+LE+P+   DLSM+VLLP+E+  L+++E+ +  EKL EWT+   M + RV ++LP+ K+
+Sbjct: 230 KVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM D+F   A+L+G++ +  L +S  +H AF+E++E+G E A +T
+Sbjct: 290 EESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAE 349
+
+Query: 123 IEDIKHSPES--EQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +     SP S  E+F  +HPFLF I+ N TN+I+++GR+ SP
+Sbjct: 350 V-GFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP 390
+
+
+>gb|AAD55765.1|AF169949_1 headpin [Homo sapiens]
+ gb|EAW63153.1| serpin peptidase inhibitor, clade B (ovalbumin), member 13, isoform
+           CRA_d [Homo sapiens]
+          Length = 391
+
+ Score =  145 bits (366), Expect = 7e-034
+ Identities = 69/161 (42%), Positives = 110/161 (68%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KIL +P+ + DLSM VLLP+++  LE+I   I+ EKL EWT+P  ME+R+V ++LP+ ++
+Sbjct: 231 KILGIPYKNNDLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERKVNLHLPRFEV 290
+
+Query: 63  EEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           E+ Y+L +VL A+GM D F    A+ +G+SS   L   + +H +F+ ++E+G E A +TG
+Sbjct: 291 EDSYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATG 350
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +   +  +P  E    +HPFLF I+HN +N+I++FGR+ SP
+Sbjct: 351 IGFTVTSAPGHENVHCNHPFLFFIRHNESNSILFFGRFSSP 391
+
+
+>dbj|BAE32772.1| unnamed protein product [Mus musculus]
+          Length = 378
+
+ Score =  145 bits (366), Expect = 7e-034
+ Identities = 70/160 (43%), Positives = 107/160 (66%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KIL LP+ S +L+M+++LPDE  +L  +EK + +EK  EWT  + M++  V+V+LP+ K+
+Sbjct: 219 KILLLPYVSSELNMIIMLPDEHVELGTVEKEVTYEKFIEWTRLDKMDEEEVEVFLPKFKL 278
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE YN+   L  LGMTD F   A+ +G+SS + L +S+ VH AF+E++E+G E A +T
+Sbjct: 279 EENYNMNDALYKLGMTDAFGGRADFSGMSSKQGLFLSKVVHKAFVEVNEEGTEAAAATAG 338
+
+Query: 123 IEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +  ++    + +F ADHPFLF I H  TN I++ GR+ SP
+Sbjct: 339 MMTVRCMRFTPRFCADHPFLFFIHHVKTNGILFCGRFSSP 378
+
+
+>ref|XP_001091509.1| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B (ovalbumin), member 11 isoform 1 [Macaca
+           mulatta]
+          Length = 305
+
+ Score =  145 bits (365), Expect = 9e-034
+ Identities = 70/163 (42%), Positives = 114/163 (69%), Gaps = 1/163 (0%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           +M++LELP+ +  LSM++LLP   +++++IEK +N     EWT+ + M +R V+V+LP+
+Sbjct: 143 QMQVLELPYVNNKLSMIILLPVGTANVKQIEKQLNSRTFHEWTSSSNMMEREVEVHLPRF 202
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGS 119
+           K+E KY L S+L +LG+TDLF    A+L+G+S  + L +S+A+H +++++SE+G E A +
+Sbjct: 203 KLEIKYELNSLLKSLGVTDLFNQVKADLSGMSPTKGLYLSKAIHKSYLDVSEEGTEAAAA 262
+
+Query: 120 TGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           TG    +K  P   QF+A+HPFLF I+H  TN I++ G+  SP
+Sbjct: 263 TGDSIAVKSLPMRAQFKANHPFLFFIRHTHTNVILFCGKLASP 305
+
+
+>ref|XP_001091618.1| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B (ovalbumin), member 11 isoform 2 [Macaca
+           mulatta]
+          Length = 392
+
+ Score =  145 bits (365), Expect = 9e-034
+ Identities = 70/163 (42%), Positives = 114/163 (69%), Gaps = 1/163 (0%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           +M++LELP+ +  LSM++LLP   +++++IEK +N     EWT+ + M +R V+V+LP+
+Sbjct: 230 QMQVLELPYVNNKLSMIILLPVGTANVKQIEKQLNSRTFHEWTSSSNMMEREVEVHLPRF 289
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGS 119
+           K+E KY L S+L +LG+TDLF    A+L+G+S  + L +S+A+H +++++SE+G E A +
+Sbjct: 290 KLEIKYELNSLLKSLGVTDLFNQVKADLSGMSPTKGLYLSKAIHKSYLDVSEEGTEAAAA 349
+
+Query: 120 TGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           TG    +K  P   QF+A+HPFLF I+H  TN I++ G+  SP
+Sbjct: 350 TGDSIAVKSLPMRAQFKANHPFLFFIRHTHTNVILFCGKLASP 392
+
+
+>gb|AAQ04218.1|AF428135_1 SCCA1/SCCA2 fusion protein [Homo sapiens]
+ gb|AAQ04219.1|AF428136_1 SCCA1/SCCA2 fusion protein [Homo sapiens]
+ gb|AAQ04220.1|AF428137_1 SCCA1/SCCA2 fusion protein [Homo sapiens]
+ gb|AAQ04221.1|AF428138_1 SCCA1/SCCA2 fusion protein [Homo sapiens]
+ gb|AAQ04222.1|AF428139_1 SCCA1/SCCA2 fusion protein [Homo sapiens]
+          Length = 390
+
+ Score =  145 bits (365), Expect = 9e-034
+ Identities = 67/161 (41%), Positives = 112/161 (69%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K+LE+P+   DLSM+VLLP+E+  L+++E+ +  EKL EWT+   M +  V ++LP+ K+
+Sbjct: 230 KVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETCVDLHLPRFKM 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM ++F   A+L+G++ +  L +S+ +H AF+E++E+G+E A +T V
+Sbjct: 290 EESYDLKDTLRTMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAV 349
+
+Query: 123 IEDIKHSPE-SEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +     SP  +E+F  +HPFLF I+ N TN+I+++GR+ SP
+Sbjct: 350 VVVELSSPSTNEEFCCNHPFLFFIRQNKTNSILFYGRFSSP 390
+
+
+>ref|NP_002965.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 4 [Homo sapiens]
+ sp|P48594|SPB4_HUMAN Serpin B4 (Squamous cell carcinoma antigen 2) (SCCA-2) (Leupin)
+ emb|CAA61420.1| leupin [Homo sapiens]
+ gb|AAA97553.1| squamous cell carcinoma antigen 2
+ gb|AAA92602.1| squamous cell carcinoma antigen
+ dbj|BAB21525.1| squamous cell carcinoma antigen 2 [Homo sapiens]
+ gb|AAH17401.1| Serpin peptidase inhibitor, clade B (ovalbumin), member 4 [Homo
+           sapiens]
+ gb|EAW63155.1| serpin peptidase inhibitor, clade B (ovalbumin), member 4, isoform
+           CRA_b [Homo sapiens]
+ gb|ABM83720.1| serpin peptidase inhibitor, clade B (ovalbumin), member 4
+           [synthetic construct]
+ gb|ABM87040.1| serpin peptidase inhibitor, clade B (ovalbumin), member 4
+           [synthetic construct]
+          Length = 390
+
+ Score =  145 bits (365), Expect = 9e-034
+ Identities = 67/161 (41%), Positives = 112/161 (69%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K+LE+P+   DLSM+VLLP+E+  L+++E+ +  EKL EWT+   M +  V ++LP+ K+
+Sbjct: 230 KVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETCVDLHLPRFKM 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM ++F   A+L+G++ +  L +S+ +H AF+E++E+G+E A +T V
+Sbjct: 290 EESYDLKDTLRTMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAV 349
+
+Query: 123 IEDIKHSPE-SEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +     SP  +E+F  +HPFLF I+ N TN+I+++GR+ SP
+Sbjct: 350 VVVELSSPSTNEEFCCNHPFLFFIRQNKTNSILFYGRFSSP 390
+
+
+>pir||I38202 leupin precursor - human
+          Length = 390
+
+ Score =  145 bits (365), Expect = 9e-034
+ Identities = 67/161 (41%), Positives = 112/161 (69%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K+LE+P+   DLSM+VLLP+E+  L+++E+ +  EKL EWT+   M +  V ++LP+ K+
+Sbjct: 230 KVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETCVDLHLPRFKM 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM ++F   A+L+G++ +  L +S+ +H AF+E++E+G+E A +T V
+Sbjct: 290 EESYDLKDTLRTMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAV 349
+
+Query: 123 IEDIKHSPE-SEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +     SP  +E+F  +HPFLF I+ N TN+I+++GR+ SP
+Sbjct: 350 VVFELSSPSTNEEFCCNHPFLFFIRQNKTNSILFYGRFSSP 390
+
+
+>dbj|BAB40773.1| SCCA2b [Homo sapiens]
+ gb|EAW63154.1| serpin peptidase inhibitor, clade B (ovalbumin), member 4, isoform
+           CRA_a [Homo sapiens]
+          Length = 369
+
+ Score =  145 bits (365), Expect = 9e-034
+ Identities = 67/161 (41%), Positives = 112/161 (69%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K+LE+P+   DLSM+VLLP+E+  L+++E+ +  EKL EWT+   M +  V ++LP+ K+
+Sbjct: 209 KVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETCVDLHLPRFKM 268
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM ++F   A+L+G++ +  L +S+ +H AF+E++E+G+E A +T V
+Sbjct: 269 EESYDLKDTLRTMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAV 328
+
+Query: 123 IEDIKHSPE-SEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +     SP  +E+F  +HPFLF I+ N TN+I+++GR+ SP
+Sbjct: 329 VVVELSSPSTNEEFCCNHPFLFFIRQNKTNSILFYGRFSSP 369
+
+
+>ref|XP_001090669.1| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 13 [Macaca mulatta]
+          Length = 391
+
+ Score =  144 bits (364), Expect = 1e-033
+ Identities = 69/161 (42%), Positives = 110/161 (68%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KIL +P+ + DLSM VLLP+++  LE+I   I+ EKL EWT+P  ME+RRV ++LP+ ++
+Sbjct: 231 KILGIPYKNNDLSMFVLLPNDIDGLEKIIDKISPEKLIEWTSPGHMEERRVNLHLPRFEV 290
+
+Query: 63  EEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           E+ Y+L +VL A+G+ D F    A+ +G+SS   L   + +H +F+ ++E+G E A +TG
+Sbjct: 291 EDSYDLEAVLAAMGIGDAFSEHKADYSGMSSLSGLHAQKFLHSSFVAVTEEGTEAAAATG 350
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +   +  +P  E    +HPFLF I+HN +N+I++FGR+ SP
+Sbjct: 351 IGFTVTSAPGHENVHCNHPFLFFIRHNESNSILFFGRFSSP 391
+
+
+>gb|AAU14875.1| leukocyte elastase inhibitor [Oncorhynchus mykiss]
+          Length = 380
+
+ Score =  144 bits (364), Expect = 1e-033
+ Identities = 70/165 (42%), Positives = 112/165 (67%), Gaps = 5/165 (3%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVYLP 58
+           +ILELP+   +LSML++LP+E+ D    L+++EK + ++ L EWT P+ M    V+V LP
+Sbjct: 216 QILELPYVGNELSMLIMLPNEMEDDTTGLKKLEKELTYKNLVEWTRPDMMNTVEVQVGLP 275
+
+Query: 59  QMKIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMA 117
+           + K+EE  +L  +L ++GMTD F    ++ +G+S    L +S+ +H AF+E++E+G E A
+Sbjct: 276 KFKLEESLDLKDLLASMGMTDAFDHCKSDFSGMSPDNDLVLSKVIHKAFVEVNEEGTEAA 335
+
+Query: 118 GSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           G+T  I  ++ +  +  F ADHPFLF I+HNPT +I+++GRY SP
+Sbjct: 336 GATAAIMMMRCAMRTPTFVADHPFLFFIRHNPTQSILFYGRYCSP 380
+
+
+>gb|AAQ04771.1|AF461147_1 SCCA2/SCCA1 fusion protein isoform 2 [Homo sapiens]
+          Length = 390
+
+ Score =  144 bits (364), Expect = 1e-033
+ Identities = 68/162 (41%), Positives = 112/162 (69%), Gaps = 3/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K+LE+P+   DLSM+VLLP+E+  L+++E+ +  EKL EWT+   M +  V ++LP+ K+
+Sbjct: 230 KVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETCVDLHLPRFKM 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM ++F   A+L+G++ +  L +S+ +H AF+E++E+G+E A +T V
+Sbjct: 290 EESYDLKDTLRTMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAV 349
+
+Query: 123 IEDIKHSPES--EQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +     SP S  E+F  +HPFLF I+ N TN+I+++GR+ SP
+Sbjct: 350 V-GFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP 390
+
+
+>emb|CAA04937.1| hurpin [Homo sapiens]
+          Length = 390
+
+ Score =  144 bits (364), Expect = 1e-033
+ Identities = 69/161 (42%), Positives = 110/161 (68%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KIL +P+ + DLSM VLLP+++  LE+I   I+ EKL EWT+P  ME+R+V ++LP+ ++
+Sbjct: 230 KILGIPYKNNDLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERKVNLHLPRFEV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           E+ Y+L +VL A+GM D F    A+ +G+SS   L   + +H +F+ ++E+G E A +TG
+Sbjct: 290 EDGYDLQAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATG 349
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +   +  +P  E    +HPFLF I+HN +N+I++FGR+ SP
+Sbjct: 350 IGFTVTSAPGHENVHCNHPFLFFIRHNESNSILFFGRFSSP 390
+
+
+>ref|NP_001026812.1| serine (or cysteine) proteinase inhibitor, clade B, member 1a
+           [Rattus norvegicus]
+ gb|AAH98686.1| Serine (or cysteine) proteinase inhibitor, clade B, member 1a
+           [Rattus norvegicus]
+          Length = 379
+
+ Score =  144 bits (364), Expect = 1e-033
+ Identities = 77/167 (46%), Positives = 108/167 (64%), Gaps = 5/167 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K K+LE+P+  G+LSM++LLP+++ D    L++IE+ I  EKL EWT    +E   V V
+Sbjct: 213 KCKVLEMPYQGGELSMVILLPEDIEDESTGLKKIEEQITLEKLREWTKRENLENIDVHVK 272
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ KIEE Y L S L  LG+ DLF  S A+L+G+S +  L IS+ VH AF+E++E+G E
+Sbjct: 273 LPRFKIEESYILNSNLGRLGLQDLFNSSKADLSGMSGSRDLFISKIVHKAFVEVNEEGTE 332
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +T  I         E+F ADHPF+F I+HNPT  +++ GR  SP
+Sbjct: 333 AAAATAGIATFCMLLPEEEFTADHPFIFFIRHNPTANVLFLGRVCSP 379
+
+
+>ref|NP_036529.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 13 [Homo sapiens]
+ sp|Q9UIV8|SPB13_HUMAN Serpin B13 (Hurpin) (HaCaT UV-repressible serpin) (Protease
+           inhibitor 13) (Headpin)
+ gb|AAF72879.1|AF216854_1 headpin [Homo sapiens]
+ emb|CAA04935.2| hurpin [Homo sapiens]
+ emb|CAA04936.2| hurpin [Homo sapiens]
+ gb|AAI01822.1| Serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 13 [Homo sapiens]
+          Length = 391
+
+ Score =  144 bits (364), Expect = 1e-033
+ Identities = 69/161 (42%), Positives = 110/161 (68%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KIL +P+ + DLSM VLLP+++  LE+I   I+ EKL EWT+P  ME+R+V ++LP+ ++
+Sbjct: 231 KILGIPYKNNDLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERKVNLHLPRFEV 290
+
+Query: 63  EEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           E+ Y+L +VL A+GM D F    A+ +G+SS   L   + +H +F+ ++E+G E A +TG
+Sbjct: 291 EDGYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATG 350
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +   +  +P  E    +HPFLF I+HN +N+I++FGR+ SP
+Sbjct: 351 IGFTVTSAPGHENVHCNHPFLFFIRHNESNSILFFGRFSSP 391
+
+
+>ref|XP_001251041.1| PREDICTED: similar to SCCA2/SCCA1 fusion protein isoform 3 [Bos
+           taurus]
+          Length = 398
+
+ Score =  144 bits (363), Expect = 1e-033
+ Identities = 78/169 (46%), Positives = 106/169 (62%), Gaps = 9/169 (5%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERI-------EKTINFEKLTEWTNPNTMEKRRVKV 55
+           KILE+P+   +LSM+VLLP+EV  L+ +       E  +  EKL  WT+P  M KR V +
+Sbjct: 230 KILEIPYKGEELSMMVLLPNEVDGLQEVKPGIHSLEDQLTAEKLIAWTSPQNMGKREVDL 289
+
+Query: 56  YLPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGI 114
+           YLP+ K+EE Y+L   L ALGM D F    AN +G++    L +S+  H +F+E++E+G
+Sbjct: 290 YLPRFKVEESYDLVPTLKALGMVDAFNDKVANFSGMTGRRDLVVSKVFHKSFVEVTEEGT 349
+
+Query: 115 EMAGSTGV-IEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           E A +TGV +  I   P  E FR DHPFLFLIKH  TN+I++ GR  SP
+Sbjct: 350 EAAAATGVGVAVITSLPIRESFRCDHPFLFLIKHIKTNSILFGGRVSSP 398
+
+
+>gb|EAW63160.1| serpin peptidase inhibitor, clade B (ovalbumin), member 2, isoform
+           CRA_a [Homo sapiens]
+          Length = 382
+
+ Score =  144 bits (363), Expect = 1e-033
+ Identities = 76/167 (45%), Positives = 109/167 (65%), Gaps = 6/167 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILELP+A GD+SM +LLPDE++D    LE +E  I ++KL +WT+ + M +  V+VY
+Sbjct: 217 KAQILELPYA-GDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKMAEDEVEVY 275
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           +PQ K+EE Y L S+L ++GM D F    AN +G+S    L +S+  H A ++++E+G E
+Sbjct: 276 IPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTE 335
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A  TG +   +      QF ADHPFLFLI H  TN I++FGR+ SP
+Sbjct: 336 AAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSP 382
+
+
+>pdb|2ARQ|A Chain A, Human Plasminogen Activator Inhibitor-2.[loop (66-98)
+           Deletion Mutant] Complexed With Peptide N-Acetyl-
+           Teaaagdggvmtgr-Oh
+ pdb|2ARR|A Chain A, Human Plasminogen Activator Inhibitor-2.[loop (66-98)
+           Deletion Mutant] Complexed With Peptide N-Acetyl-
+           Teaaagmggvmtgr-Oh
+          Length = 382
+
+ Score =  144 bits (363), Expect = 1e-033
+ Identities = 76/167 (45%), Positives = 109/167 (65%), Gaps = 6/167 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILELP+A GD+SM +LLPDE++D    LE +E  I ++KL +WT+ + M +  V+VY
+Sbjct: 217 KAQILELPYA-GDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKMAEDEVEVY 275
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           +PQ K+EE Y L S+L ++GM D F    AN +G+S    L +S+  H A ++++E+G E
+Sbjct: 276 IPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTE 335
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A  TG +   +      QF ADHPFLFLI H  TN I++FGR+ SP
+Sbjct: 336 AAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSP 382
+
+
+>gb|AAX41106.1| serine or cysteine proteinase inhibitor clade B member 2 [synthetic
+           construct]
+          Length = 415
+
+ Score =  144 bits (363), Expect = 1e-033
+ Identities = 76/167 (45%), Positives = 109/167 (65%), Gaps = 6/167 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILELP+A GD+SM +LLPDE++D    LE +E  I ++KL +WT+ + M +  V+VY
+Sbjct: 250 KAQILELPYA-GDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKMAEDEVEVY 308
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           +PQ K+EE Y L S+L ++GM D F    AN +G+S    L +S+  H A ++++E+G E
+Sbjct: 309 IPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTE 368
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A  TG +   +      QF ADHPFLFLI H  TN I++FGR+ SP
+Sbjct: 369 AAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSP 415
+
+
+>gb|AAH12609.1| Serpin peptidase inhibitor, clade B (ovalbumin), member 2 [Homo
+           sapiens]
+ gb|ABM83793.1| serpin peptidase inhibitor, clade B (ovalbumin), member 2
+           [synthetic construct]
+ gb|ABM87115.1| serpin peptidase inhibitor, clade B (ovalbumin), member 2
+           [synthetic construct]
+          Length = 415
+
+ Score =  144 bits (363), Expect = 1e-033
+ Identities = 76/167 (45%), Positives = 109/167 (65%), Gaps = 6/167 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILELP+A GD+SM +LLPDE++D    LE +E  I ++KL +WT+ + M +  V+VY
+Sbjct: 250 KAQILELPYA-GDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKMAEDEVEVY 308
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           +PQ K+EE Y L S+L ++GM D F    AN +G+S    L +S+  H A ++++E+G E
+Sbjct: 309 IPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTE 368
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A  TG +   +      QF ADHPFLFLI H  TN I++FGR+ SP
+Sbjct: 369 AAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSP 415
+
+
+>ref|NP_002566.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 2 [Homo sapiens]
+ sp|P05120|PAI2_HUMAN Plasminogen activator inhibitor 2 precursor (PAI-2) (Placental
+           plasminogen activator inhibitor) (Monocyte Arg-serpin)
+           (Urokinase inhibitor)
+ emb|CAA68666.1| unnamed protein product [Homo sapiens]
+ gb|AAA60004.1| plasminogen activator inhibitor precursor
+ gb|AAA36797.1| urokinase inhibitor
+ gb|AAA60348.1| plasminogen activator inhibitor-2
+ gb|AAX36272.1| serine or cysteine proteinase inhibitor clade B member 2 [synthetic
+           construct]
+ gb|EAW63161.1| serpin peptidase inhibitor, clade B (ovalbumin), member 2, isoform
+           CRA_b [Homo sapiens]
+          Length = 415
+
+ Score =  144 bits (363), Expect = 1e-033
+ Identities = 76/167 (45%), Positives = 109/167 (65%), Gaps = 6/167 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILELP+A GD+SM +LLPDE++D    LE +E  I ++KL +WT+ + M +  V+VY
+Sbjct: 250 KAQILELPYA-GDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKMAEDEVEVY 308
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           +PQ K+EE Y L S+L ++GM D F    AN +G+S    L +S+  H A ++++E+G E
+Sbjct: 309 IPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTE 368
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A  TG +   +      QF ADHPFLFLI H  TN I++FGR+ SP
+Sbjct: 369 AAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSP 415
+
+
+>pdb|1BY7|A Chain A, Human Plasminogen Activator Inhibitor-2. Loop (66-98)
+           Deletion Mutant
+ pdb|1JRR|A Chain A, Human Plasminogen Activator Inhibitor-2.[loop (66-98)
+           Deletionmutant] Complexed With Peptide Mimicking The
+           Reactive Center Loop
+          Length = 382
+
+ Score =  144 bits (363), Expect = 1e-033
+ Identities = 76/167 (45%), Positives = 109/167 (65%), Gaps = 6/167 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILELP+A GD+SM +LLPDE++D    LE +E  I ++KL +WT+ + M +  V+VY
+Sbjct: 217 KAQILELPYA-GDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKMAEDEVEVY 275
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           +PQ K+EE Y L S+L ++GM D F    AN +G+S    L +S+  H A ++++E+G E
+Sbjct: 276 IPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTE 335
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A  TG +   +      QF ADHPFLFLI H  TN I++FGR+ SP
+Sbjct: 336 AAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSP 382
+
+
+>ref|XP_001141918.1| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 3 [Pan troglodytes]
+          Length = 390
+
+ Score =  144 bits (362), Expect = 2e-033
+ Identities = 68/162 (41%), Positives = 111/162 (68%), Gaps = 3/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           ++LE+P+   DLSM+VLLP+E+  L+++E+ +  EKL EWT+   M +  V ++LP+ K+
+Sbjct: 230 RVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRQTPVDLHLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM D+F   A+L+G++ +  L +S  +H AF+E++E+G E A +T V
+Sbjct: 290 EESYDLKDTLRTMGMVDIFNGDADLSGMTGSHGLVLSGVLHKAFVEVTEEGAEAAAATTV 349
+
+Query: 123 IEDIKHSPES--EQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +  +  SP S  E+F  +HPFLF I+ N TN+I+++GR+ SP
+Sbjct: 350 V-PLGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP 390
+
+
+>ref|XP_001148015.1| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 3 isoform 5 [Pan troglodytes]
+          Length = 369
+
+ Score =  144 bits (362), Expect = 2e-033
+ Identities = 68/162 (41%), Positives = 111/162 (68%), Gaps = 3/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           ++LE+P+   DLSM+VLLP+E+  L+++E+ +  EKL EWT+   M +  V ++LP+ K+
+Sbjct: 209 RVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETPVDLHLPRFKV 268
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM D+F   A+L+G++ +  L +S  +H AF+E++E+G E A +T V
+Sbjct: 269 EESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATTV 328
+
+Query: 123 IEDIKHSPES--EQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +  +  SP S  E+F  +HPFLF I+ N TN+I+++GR+ SP
+Sbjct: 329 V-PLGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP 369
+
+
+>ref|XP_512165.1| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 3 isoform 6 [Pan troglodytes]
+          Length = 390
+
+ Score =  144 bits (362), Expect = 2e-033
+ Identities = 68/162 (41%), Positives = 111/162 (68%), Gaps = 3/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           ++LE+P+   DLSM+VLLP+E+  L+++E+ +  EKL EWT+   M +  V ++LP+ K+
+Sbjct: 230 RVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETPVDLHLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM D+F   A+L+G++ +  L +S  +H AF+E++E+G E A +T V
+Sbjct: 290 EESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATTV 349
+
+Query: 123 IEDIKHSPES--EQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +  +  SP S  E+F  +HPFLF I+ N TN+I+++GR+ SP
+Sbjct: 350 V-PLGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP 390
+
+
+>ref|XP_512167.2| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 8 [Pan troglodytes]
+          Length = 488
+
+ Score =  143 bits (361), Expect = 3e-033
+ Identities = 67/161 (41%), Positives = 110/161 (68%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           ++LELP+   +LSM++LLPD+ +DL  +EK + +EK   WTN   + K +V+V+LP++K+
+Sbjct: 328 QVLELPYVEEELSMVILLPDDNTDLAVVEKALTYEKFKAWTNSEKLTKSKVQVFLPRLKL 387
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y+L   L  LGM D F  + A+ +G+S+ +++ +S+  H  F+E++E+G E A +T
+Sbjct: 388 EESYDLEPFLRRLGMIDAFDEAKADFSGMSTKKNVPLSKVAHKCFVEVNEEGTEAAAATA 447
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V+ + + S    +F ADHPFLF I+H+ TN I++ GR+ SP
+Sbjct: 448 VVRNSRCSRMEPRFCADHPFLFFIRHHKTNCILFCGRFSSP 488
+
+
+>emb|CAE11879.1| hypothetical protein [Homo sapiens]
+          Length = 374
+
+ Score =  143 bits (361), Expect = 3e-033
+ Identities = 67/161 (41%), Positives = 110/161 (68%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           ++LELP+   +LSM++LLPD+ +DL  +EK + +EK   WTN   + K +V+V+LP++K+
+Sbjct: 214 QVLELPYVEEELSMVILLPDDNTDLAVVEKALTYEKFKAWTNSEKLTKSKVQVFLPRLKL 273
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y+L   L  LGM D F  + A+ +G+S+ +++ +S+  H  F+E++E+G E A +T
+Sbjct: 274 EESYDLEPFLRRLGMIDAFDEAKADFSGMSAEKNVPLSKVAHKCFVEVNEEGTEAAAATA 333
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V+ + + S    +F ADHPFLF I+H+ TN I++ GR+ SP
+Sbjct: 334 VVRNSRCSRMEPRFCADHPFLFFIRHHKTNCILFCGRFSSP 374
+
+
+>ref|NP_942130.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 8 isoform a [Homo sapiens]
+ ref|NP_002631.3| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 8 isoform a [Homo sapiens]
+ gb|EAW63163.1| serpin peptidase inhibitor, clade B (ovalbumin), member 8, isoform
+           CRA_a [Homo sapiens]
+ gb|EAW63165.1| serpin peptidase inhibitor, clade B (ovalbumin), member 8, isoform
+           CRA_a [Homo sapiens]
+          Length = 374
+
+ Score =  143 bits (361), Expect = 3e-033
+ Identities = 67/161 (41%), Positives = 110/161 (68%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           ++LELP+   +LSM++LLPD+ +DL  +EK + +EK   WTN   + K +V+V+LP++K+
+Sbjct: 214 QVLELPYVEEELSMVILLPDDNTDLAVVEKALTYEKFKAWTNSEKLTKSKVQVFLPRLKL 273
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y+L   L  LGM D F  + A+ +G+S+ +++ +S+  H  F+E++E+G E A +T
+Sbjct: 274 EESYDLEPFLRRLGMIDAFDEAKADFSGMSTEKNVPLSKVAHKCFVEVNEEGTEAAAATA 333
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V+ + + S    +F ADHPFLF I+H+ TN I++ GR+ SP
+Sbjct: 334 VVRNSRCSRMEPRFCADHPFLFFIRHHKTNCILFCGRFSSP 374
+
+
+>ref|XP_001093135.1| PREDICTED: serpin peptidase inhibitor, clade B (ovalbumin), member
+           6 isoform 4 [Macaca mulatta]
+          Length = 340
+
+ Score =  143 bits (360), Expect = 3e-033
+ Identities = 67/161 (41%), Positives = 109/161 (67%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           ++LELP+   +LSM++LLPD+ +DL  +EK + +EK   WTN   + K +V+V+LP++K+
+Sbjct: 180 QVLELPYVEEELSMIILLPDDDTDLAVVEKALTYEKFKAWTNSEKLTKSKVQVFLPRLKL 239
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y+L   L  LGM D F  + A+ +G+S+ +++ +S+  H  F+E++E+G E A +T
+Sbjct: 240 EESYDLEPFLRRLGMIDAFDEAKADFSGMSTKKNVPVSKVAHKCFVEVNEEGTEAAAATA 299
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V+ + + S    +F ADHPFLF I+H+ TN I + GR+ SP
+Sbjct: 300 VVRNSRCSRMEPRFCADHPFLFFIRHHKTNGIFFCGRFSSP 340
+
+
+>ref|XP_001091973.1| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 2 isoform 1 [Macaca mulatta]
+          Length = 392
+
+ Score =  142 bits (359), Expect = 4e-033
+ Identities = 75/167 (44%), Positives = 109/167 (65%), Gaps = 6/167 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILELP+A GD+SM +LLPDE++D    LE +E  I ++KL +WT+ +TM +  V+VY
+Sbjct: 227 KAQILELPYA-GDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDTMAEDDVEVY 285
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           +PQ K+EE Y L S+L ++GM D F    AN +G+S    L +S+  H A ++++E+G E
+Sbjct: 286 IPQFKLEEHYELKSILRSMGMEDAFDKGQANFSGMSERNDLFLSEVFHQAMVDVNEEGTE 345
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A  TG +   +      QF ADHPFLFLI H  T  I++FG++ SP
+Sbjct: 346 AAAGTGGVMSGRTGHGGPQFVADHPFLFLIMHKITKCILFFGKFSSP 392
+
+
+>ref|XP_001092213.1| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 2 isoform 3 [Macaca mulatta]
+          Length = 379
+
+ Score =  142 bits (359), Expect = 4e-033
+ Identities = 75/167 (44%), Positives = 109/167 (65%), Gaps = 6/167 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILELP+A GD+SM +LLPDE++D    LE +E  I ++KL +WT+ +TM +  V+VY
+Sbjct: 214 KAQILELPYA-GDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDTMAEDDVEVY 272
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           +PQ K+EE Y L S+L ++GM D F    AN +G+S    L +S+  H A ++++E+G E
+Sbjct: 273 IPQFKLEEHYELKSILRSMGMEDAFDKGQANFSGMSERNDLFLSEVFHQAMVDVNEEGTE 332
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A  TG +   +      QF ADHPFLFLI H  T  I++FG++ SP
+Sbjct: 333 AAAGTGGVMSGRTGHGGPQFVADHPFLFLIMHKITKCILFFGKFSSP 379
+
+
+>ref|XP_001092087.1| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 2 isoform 2 [Macaca mulatta]
+          Length = 386
+
+ Score =  142 bits (359), Expect = 4e-033
+ Identities = 75/167 (44%), Positives = 109/167 (65%), Gaps = 6/167 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILELP+A GD+SM +LLPDE++D    LE +E  I ++KL +WT+ +TM +  V+VY
+Sbjct: 221 KAQILELPYA-GDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDTMAEDDVEVY 279
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           +PQ K+EE Y L S+L ++GM D F    AN +G+S    L +S+  H A ++++E+G E
+Sbjct: 280 IPQFKLEEHYELKSILRSMGMEDAFDKGQANFSGMSERNDLFLSEVFHQAMVDVNEEGTE 339
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A  TG +   +      QF ADHPFLFLI H  T  I++FG++ SP
+Sbjct: 340 AAAGTGGVMSGRTGHGGPQFVADHPFLFLIMHKITKCILFFGKFSSP 386
+
+
+>ref|XP_001092329.1| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 2 isoform 4 [Macaca mulatta]
+          Length = 415
+
+ Score =  142 bits (359), Expect = 4e-033
+ Identities = 75/167 (44%), Positives = 109/167 (65%), Gaps = 6/167 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILELP+A GD+SM +LLPDE++D    LE +E  I ++KL +WT+ +TM +  V+VY
+Sbjct: 250 KAQILELPYA-GDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDTMAEDDVEVY 308
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           +PQ K+EE Y L S+L ++GM D F    AN +G+S    L +S+  H A ++++E+G E
+Sbjct: 309 IPQFKLEEHYELKSILRSMGMEDAFDKGQANFSGMSERNDLFLSEVFHQAMVDVNEEGTE 368
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A  TG +   +      QF ADHPFLFLI H  T  I++FG++ SP
+Sbjct: 369 AAAGTGGVMSGRTGHGGPQFVADHPFLFLIMHKITKCILFFGKFSSP 415
+
+
+>ref|XP_857036.1| PREDICTED: similar to Squamous cell carcinoma antigen 2 (SCCA-2)
+           (Leupin) isoform 3 [Canis familiaris]
+          Length = 368
+
+ Score =  142 bits (359), Expect = 4e-033
+ Identities = 74/161 (45%), Positives = 102/161 (63%), Gaps = 2/161 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KILE+P+   DLSM++LLP EV  L+++E  +  E L EWT+   M   +V +YLP+ K+
+Sbjct: 209 KILEIPYKGKDLSMMLLLPHEVDGLQKLEDQLTAENLIEWTSSQNMSNGQVDLYLPRFKV 268
+
+Query: 63  EEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y L + L ALGM D F    AN +G++  + L +S+  H +F+E++E+G E A ST
+Sbjct: 269 EESYELKATLKALGMVDAFNTKRANFSGMTGRQDLVVSKVRHKSFVEVTEEGTEAAASTD 328
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V E I  S     F  DHPFLF IKHN TN+I++ GR  SP
+Sbjct: 329 V-EVIAKSAPIYPFHCDHPFLFFIKHNKTNSILFLGRVSSP 368
+
+
+>ref|XP_541074.2| PREDICTED: similar to Squamous cell carcinoma antigen 2 (SCCA-2)
+           (Leupin) isoform 1 [Canis familiaris]
+          Length = 389
+
+ Score =  142 bits (359), Expect = 4e-033
+ Identities = 74/161 (45%), Positives = 102/161 (63%), Gaps = 2/161 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KILE+P+   DLSM++LLP EV  L+++E  +  E L EWT+   M   +V +YLP+ K+
+Sbjct: 230 KILEIPYKGKDLSMMLLLPHEVDGLQKLEDQLTAENLIEWTSSQNMSNGQVDLYLPRFKV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y L + L ALGM D F    AN +G++  + L +S+  H +F+E++E+G E A ST
+Sbjct: 290 EESYELKATLKALGMVDAFNTKRANFSGMTGRQDLVVSKVRHKSFVEVTEEGTEAAASTD 349
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V E I  S     F  DHPFLF IKHN TN+I++ GR  SP
+Sbjct: 350 V-EVIAKSAPIYPFHCDHPFLFFIKHNKTNSILFLGRVSSP 389
+
+
+>ref|XP_527219.2| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 1 [Pan troglodytes]
+          Length = 508
+
+ Score =  142 bits (358), Expect = 6e-033
+ Identities = 74/167 (44%), Positives = 108/167 (64%), Gaps = 5/167 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K ++LELP+   +LSM++LLPD++ D    L++IE+ +  EKL EWT P  ++   V V
+Sbjct: 342 KCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFVEVNVS 401
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ K+EE Y L S L  LG+ DLF  S A+L+G+S A  + IS+ VH +F+E++E+G E
+Sbjct: 402 LPRFKLEESYTLNSDLARLGVQDLFNSSRADLSGMSGARDIFISKIVHKSFVEVNEEGTE 461
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +T  I         E F ADHPFLF I+HN + +I++ GR+ SP
+Sbjct: 462 AAAATAGIATFCMLMPEENFTADHPFLFFIRHNSSGSILFLGRFSSP 508
+
+
+>ref|XP_001107117.1| PREDICTED: similar to Serpin B6 (Placental thrombin inhibitor)
+           (Cytoplasmic antiproteinase) (CAP) (Protease inhibitor
+           6) (PI-6), partial [Macaca mulatta]
+          Length = 185
+
+ Score =  142 bits (358), Expect = 6e-033
+ Identities = 70/161 (43%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +IL LP+   +L+M+++LPDE +DL  +EK + +EK  EWT  + M++ +V+V LP+ K+
+Sbjct: 26  QILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEKVEVSLPRFKL 85
+
+Query: 63  EEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y++ SVL +LGMTD F +  A+ +G+S A+ L +S+ VH +F+E++E+G E A +T
+Sbjct: 86  EESYDMESVLCSLGMTDAFELGKADFSGMSKAD-LCLSKVVHKSFVEVNEEGTEAAAATA 144
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            I  ++ +    +F ADHPFLF I+H+ TN I++ GR+ SP
+Sbjct: 145 AIMMMRCARFVPRFCADHPFLFFIQHSKTNGILFCGRFSSP 185
+
+
+>gb|AAP36298.1| Homo sapiens serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 1 [synthetic construct]
+ gb|AAX43644.1| serine or cysteine proteinase inhibitor clade B member 1 [synthetic
+           construct]
+          Length = 380
+
+ Score =  142 bits (358), Expect = 6e-033
+ Identities = 74/167 (44%), Positives = 108/167 (64%), Gaps = 5/167 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K ++LELP+   +LSM++LLPD++ D    L++IE+ +  EKL EWT P  ++   V V
+Sbjct: 213 KCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVS 272
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ K+EE Y L S L  LG+ DLF  S A+L+G+S A  + IS+ VH +F+E++E+G E
+Sbjct: 273 LPRFKLEESYTLNSDLARLGVQDLFNSSKADLSGMSGARDIFISKIVHKSFVEVNEEGTE 332
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +T  I         E F ADHPFLF I+HN + +I++ GR+ SP
+Sbjct: 333 AAAATAGIATFCMLMPEENFTADHPFLFFIRHNSSGSILFLGRFSSP 379
+
+
+>gb|AAA36413.1| plasminogen activator inhibitor
+ gb|AAA60006.1| plasminogen activator inhibitor type 2 precursor
+          Length = 415
+
+ Score =  142 bits (358), Expect = 6e-033
+ Identities = 75/167 (44%), Positives = 108/167 (64%), Gaps = 6/167 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILELP+A GD+SM +LLPDE++D    LE +E  I ++KL +WT+ + M +  V+VY
+Sbjct: 250 KAQILELPYA-GDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKMAEDEVEVY 308
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           +PQ K+EE Y L S+L ++GM D F    AN +G+S    L +S+  H A ++++E+G E
+Sbjct: 309 IPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTE 368
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A  TG +   +      QF ADHPFLFLI H  T  I++FGR+ SP
+Sbjct: 369 AAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITKCILFFGRFCSP 415
+
+
+>dbj|BAD97090.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 1 variant [Homo sapiens]
+          Length = 379
+
+ Score =  142 bits (358), Expect = 6e-033
+ Identities = 74/167 (44%), Positives = 108/167 (64%), Gaps = 5/167 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K ++LELP+   +LSM++LLPD++ D    L++IE+ +  EKL EWT P  ++   V V
+Sbjct: 213 KCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVS 272
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ K+EE Y L S L  LG+ DLF  S A+L+G+S A  + IS+ VH +F+E++E+G E
+Sbjct: 273 LPRFKLEESYTLNSDLARLGVQDLFNSSKADLSGMSGARDIFISKIVHKSFVEVNEEGTE 332
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +T  I         E F ADHPFLF I+HN + +I++ GR+ SP
+Sbjct: 333 AAAATAGIATFCMLMPEENFTADHPFLFFIRHNSSGSILFLGRFSSP 379
+
+
+>ref|NP_109591.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 1 [Homo sapiens]
+ sp|P30740|ILEU_HUMAN Leukocyte elastase inhibitor (LEI) (Serpin B1) (Monocyte/neutrophil
+           elastase inhibitor) (M/NEI) (EI)
+ gb|AAC31394.1| monocyte/neutrophil elastase inhibitor [Homo sapiens]
+ gb|AAH09015.1| Serpin peptidase inhibitor, clade B (ovalbumin), member 1 [Homo
+           sapiens]
+ gb|AAP35574.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 1 [Homo sapiens]
+ emb|CAH73667.1| serpin peptidase inhibitor, clade B (ovalbumin), member 1 [Homo
+           sapiens]
+ gb|AAX31975.1| serine or cysteine proteinase inhibitor clade B member 1 [synthetic
+           construct]
+ gb|AAX31976.1| serine or cysteine proteinase inhibitor clade B member 1 [synthetic
+           construct]
+ gb|EAW55089.1| serpin peptidase inhibitor, clade B (ovalbumin), member 1, isoform
+           CRA_a [Homo sapiens]
+ gb|EAW55090.1| serpin peptidase inhibitor, clade B (ovalbumin), member 1, isoform
+           CRA_a [Homo sapiens]
+          Length = 379
+
+ Score =  142 bits (358), Expect = 6e-033
+ Identities = 74/167 (44%), Positives = 108/167 (64%), Gaps = 5/167 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K ++LELP+   +LSM++LLPD++ D    L++IE+ +  EKL EWT P  ++   V V
+Sbjct: 213 KCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVS 272
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ K+EE Y L S L  LG+ DLF  S A+L+G+S A  + IS+ VH +F+E++E+G E
+Sbjct: 273 LPRFKLEESYTLNSDLARLGVQDLFNSSKADLSGMSGARDIFISKIVHKSFVEVNEEGTE 332
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +T  I         E F ADHPFLF I+HN + +I++ GR+ SP
+Sbjct: 333 AAAATAGIATFCMLMPEENFTADHPFLFFIRHNSSGSILFLGRFSSP 379
+
+
+>ref|XP_001093348.1| PREDICTED: serpin peptidase inhibitor, clade B (ovalbumin), member
+           6 isoform 6 [Macaca mulatta]
+ ref|XP_001093243.1| PREDICTED: serpin peptidase inhibitor, clade B (ovalbumin), member
+           6 isoform 5 [Macaca mulatta]
+ ref|XP_001093458.1| PREDICTED: serpin peptidase inhibitor, clade B (ovalbumin), member
+           6 isoform 7 [Macaca mulatta]
+          Length = 378
+
+ Score =  142 bits (357), Expect = 7e-033
+ Identities = 68/161 (42%), Positives = 113/161 (70%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +IL LP+   +L+M++LLP+E +DL+ +EK +++E+  EWTNP+ M +R ++V+LP+ K+
+Sbjct: 218 QILVLPYVGKELNMIILLPNENTDLKMVEKKLSYERFIEWTNPDNMHEREMEVFLPRFKL 277
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE YN+  VL ++GM D F    A+ +G+SS + L +S+ +H +F+E++E+G E A +T
+Sbjct: 278 EETYNMEDVLRSMGMVDAFEQDRADFSGMSSKKDLYLSKVMHKSFVEVNEEGTEAAAATT 337
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+               +  +  S +F ADHPFLF I+H+ TN I++ GR+ SP
+Sbjct: 338 EEIVLCCASYSLRFCADHPFLFFIQHSKTNGILFCGRFSSP 378
+
+
+>ref|XP_001093020.1| PREDICTED: serpin peptidase inhibitor, clade B (ovalbumin), member
+           6 isoform 3 [Macaca mulatta]
+          Length = 357
+
+ Score =  142 bits (357), Expect = 7e-033
+ Identities = 68/161 (42%), Positives = 113/161 (70%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +IL LP+   +L+M++LLP+E +DL+ +EK +++E+  EWTNP+ M +R ++V+LP+ K+
+Sbjct: 197 QILVLPYVGKELNMIILLPNENTDLKMVEKKLSYERFIEWTNPDNMHEREMEVFLPRFKL 256
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE YN+  VL ++GM D F    A+ +G+SS + L +S+ +H +F+E++E+G E A +T
+Sbjct: 257 EETYNMEDVLRSMGMVDAFEQDRADFSGMSSKKDLYLSKVMHKSFVEVNEEGTEAAAATT 316
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+               +  +  S +F ADHPFLF I+H+ TN I++ GR+ SP
+Sbjct: 317 EEIVLCCASYSLRFCADHPFLFFIQHSKTNGILFCGRFSSP 357
+
+
+>ref|XP_001091156.1| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 9 [Macaca mulatta]
+          Length = 376
+
+ Score =  142 bits (357), Expect = 7e-033
+ Identities = 73/164 (44%), Positives = 112/164 (68%), Gaps = 2/164 (1%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           + ++LELP+A  +LS+LVLLPD+  +L  +EK + FEKLT WT P+ M+   V+V LP+
+Sbjct: 213 RAQLLELPYAGEELSLLVLLPDDGVELSTVEKNLTFEKLTAWTKPDCMKSTEVEVLLPKF 272
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGS 119
+           K++E Y++ SVL  LGM D F    A+L+ +S+   L +S+ VH +F+E++E+G E A +
+Sbjct: 273 KLQEDYDMESVLRRLGMVDAFQQGKADLSAMSAEGDLCLSKFVHKSFVEVNEEGTEAAAA 332
+
+Query: 120 TGVIEDIKHSPES-EQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +G I   +   ES  +F ADHPFLF I+HN  N++++ GR+ SP
+Sbjct: 333 SGCIVIAECCMESGPRFCADHPFLFFIRHNRANSLLFCGRFSSP 376
+
+
+>dbj|BAE02355.1| unnamed protein product [Macaca fascicularis]
+          Length = 376
+
+ Score =  142 bits (357), Expect = 7e-033
+ Identities = 69/161 (42%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +IL LP+   +L+M+++LPDE +DL  +EK + +EK  EWT  + M++ +V+V LP+ K+
+Sbjct: 217 QILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEKVEVSLPRFKL 276
+
+Query: 63  EEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y++ SVL +LGMTD F +  A+ +G+S A+ L +S+ VH +F+E++E+G E A +T
+Sbjct: 277 EESYDMESVLCSLGMTDAFELGKADFSGMSKAD-LCLSKVVHKSFVEVNEEGTEAAAATA 335
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            I  ++ +    +F ADHPFLF I+H+ TN +++ GR+ SP
+Sbjct: 336 AIMMMRCARFVPRFCADHPFLFFIQHSKTNGVLFCGRFSSP 376
+
+
+>ref|XP_573426.1| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B (ovalbumin), member 3A [Rattus norvegicus]
+ ref|XP_001056687.1| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B (ovalbumin), member 3A [Rattus norvegicus]
+          Length = 387
+
+ Score =  142 bits (357), Expect = 7e-033
+ Identities = 68/161 (42%), Positives = 106/161 (65%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K++E+P+   +LSM +LLP E+  L+++E+ +  +KL EWT    M    + + LP+ K+
+Sbjct: 227 KMVEIPYKGKELSMFILLPMEIDGLKKLEEQLTADKLLEWTRAENMNMIDLYLSLPRFKV 286
+
+Query: 63  EEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EEKY+L   L  +GM D F    A+ +G+SS + L +S+ +H +F+E++E+G E A +TG
+Sbjct: 287 EEKYDLPGPLQHMGMVDAFDSKKADFSGMSSTQGLMVSKVLHKSFVEVNEEGTEAAAATG 346
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V   +  +  +E F  DHPFLFLIKHN TN+I++FGR  SP
+Sbjct: 347 VEVSLTSAQITEDFNCDHPFLFLIKHNATNSILFFGRMSSP 387
+
+
+>ref|NP_714955.2| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 10 [Rattus norvegicus]
+ gb|AAH61735.1| Serine (or cysteine) peptidase inhibitor, clade B (ovalbumin),
+           member 10 [Rattus norvegicus]
+          Length = 397
+
+ Score =  142 bits (357), Expect = 7e-033
+ Identities = 67/159 (42%), Positives = 108/159 (67%), Gaps = 1/159 (0%)
+
+Query: 5   LELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEE 64
+           ++L + + + S+L+LLP+EV  L+++E+ I +EKL +WT+ + M+   V++YLP+ K+EE
+Sbjct: 239 VQLHYQNREFSLLLLLPEEVEGLKQLERAITYEKLDKWTSADMMDTYEVQLYLPKFKMEE 298
+
+Query: 65  KYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVI 123
+            Y+L S L  +GMTD F    AN + ++S  +L +S   H  F+E++E+G E A  TG
+Sbjct: 299 SYDLQSALRDMGMTDAFNQGKANFSNMTSERNLFLSNVFHKTFLEINEEGTEAAAGTGSE 358
+
+Query: 124 EDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            + +    S +  ADHPFLFLI+HN TNTI+++GR++SP
+Sbjct: 359 VNFRIKAPSIELNADHPFLFLIRHNVTNTILFYGRFYSP 397
+
+
+>ref|XP_001253249.1| PREDICTED: similar to SERPINB12 [Bos taurus]
+ ref|XP_001254670.1| PREDICTED: similar to SERPINB12 [Bos taurus]
+          Length = 436
+
+ Score =  141 bits (356), Expect = 1e-032
+ Identities = 71/167 (42%), Positives = 107/167 (64%), Gaps = 5/167 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLP----DEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILELP+  G L M+VLLP    D +  LE +E+ I +EKL  W++   M ++RV V
+Sbjct: 270 KAQILELPYTKGKLDMVVLLPSGSADNLKALEELERNITYEKLVSWSSSENMSEKRVAVS 329
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+            P+  +E+ Y+L  +L  +G+TD+F  + A+L+GIS   SL +S+ VH  F+E+ E+G +
+Sbjct: 330 FPRFTLEDSYDLNPILQDMGITDIFDETKADLSGISPRPSLYLSKVVHKTFLEVDENGTQ 389
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+              ++GV+   K SP  E F A+ PFLF I+HN T TI+++GR  SP
+Sbjct: 390 AVAASGVVGMEKSSPSWETFNANRPFLFFIRHNKTQTILFYGRVCSP 436
+
+
+>ref|XP_001091038.1| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B (ovalbumin), member 1 [Macaca mulatta]
+          Length = 379
+
+ Score =  141 bits (356), Expect = 1e-032
+ Identities = 73/167 (43%), Positives = 108/167 (64%), Gaps = 5/167 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K ++LELP+   +LSM++LLPD++ D    L++IE+ +  EKL EWT P  ++   V V
+Sbjct: 213 KCRVLELPYQGKELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVS 272
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ K+EE Y L S L  LG+ DLF  S A+L+G+S A  + IS+ VH +F+E++E+G E
+Sbjct: 273 LPRFKLEESYTLNSDLARLGVQDLFDSSKADLSGMSGARDIFISKIVHKSFVEVNEEGTE 332
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +T  +         E F ADHPFLF I+HN + +I++ GR+ SP
+Sbjct: 333 AAAATAGVATFCMLMPEEYFTADHPFLFFIRHNSSGSILFLGRFSSP 379
+
+
+>gb|AAO92271.1| squamous cell carcinoma antigen 2 [Homo sapiens]
+          Length = 390
+
+ Score =  140 bits (354), Expect = 2e-032
+ Identities = 65/161 (40%), Positives = 110/161 (68%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K+LE+P+   DLSM+VLLP+E+  L+++E+ +  EKL EWT+   M +  V ++LP+ K+
+Sbjct: 230 KVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETCVDLHLPRFKM 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +GM ++F   A+L+G++ +  L +S+ +H AF+E++E+G+E A +T V
+Sbjct: 290 EESYDLKDTLRTMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAV 349
+
+Query: 123 IEDIKHSPE-SEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +     SP  +E+   +HPFLF I+ N TN+I+++GR+  P
+Sbjct: 350 VVVELSSPSTNEELCCNHPFLFFIRQNKTNSILFYGRFSPP 390
+
+
+>gb|AAO92273.1| squamous cell carcinoma antigen 2 [Homo sapiens]
+          Length = 390
+
+ Score =  140 bits (354), Expect = 2e-032
+ Identities = 65/161 (40%), Positives = 110/161 (68%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K+LE+P+   DLSM+VLLP+E+  L+++E+ +  EKL EWT+   M +  V ++LP+ K+
+Sbjct: 230 KVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETCVDLHLPRFKM 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L  +G  ++F   A+L+G++ +  L +S+ +H AF+E++E+G+E A +T V
+Sbjct: 290 EESYDLKDTLRTMGTVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAV 349
+
+Query: 123 IEDIKHSPE-SEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +     SP  +E+F  +HPFLF I+ N TN+I+++GR+  P
+Sbjct: 350 VVVELSSPSTNEEFCCNHPFLFFIRQNKTNSILFYGRFSPP 390
+
+
+>ref|XP_418985.2| PREDICTED: similar to SERPINB12 protein [Gallus gallus]
+          Length = 416
+
+ Score =  140 bits (353), Expect = 2e-032
+ Identities = 75/166 (45%), Positives = 110/166 (66%), Gaps = 6/166 (3%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSD-----LERIEKTINFEKLTEWTNPNTMEKRRVKVYL 57
+           ++LELP+A   LSM++LLP E +D     LE+ E T+ +E L  W +   M +  V+VYL
+Sbjct: 251 QVLELPYAQKLLSMIILLPGETADGSPSGLEQTESTMTYENLMLWFSSEHMFETVVEVYL 310
+
+Query: 58  PQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEM 116
+           P+ K+E  +NL  VL A+GMTD+F  S A+L+ +SS +SL +S  VH A++E++E+G
+Sbjct: 311 PRFKLEGTFNLNEVLKAMGMTDIFSESKADLSALSSEKSLVLSNIVHKAYVEVNEEGTTA 370
+
+Query: 117 AGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           A +TG     +  P  E F AD PFLF I+HNPT+TI++FG++ SP
+Sbjct: 371 AAATGATIVRRSLPLIEVFIADRPFLFFIRHNPTSTILFFGKFCSP 416
+
+
+>sp|P50452|SPB8_HUMAN Serpin B8 (Cytoplasmic antiproteinase 2) (CAP-2) (CAP2) (Protease
+           inhibitor 8)
+ gb|AAC41939.1| cytoplasmic antiproteinase 2
+          Length = 374
+
+ Score =  140 bits (353), Expect = 2e-032
+ Identities = 66/161 (40%), Positives = 109/161 (67%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           ++LELP+   +LSM++LLPD+ +DL  +EK + +EK   WTN   + K +V+V+LP++K+
+Sbjct: 214 QVLELPYVEEELSMVILLPDDNTDLAVVEKALTYEKFKAWTNSEKLTKSKVQVFLPRLKL 273
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y+L   L  LGM D F  + A+ +G+S+ +++ +S+  H  F+E++E+G E A +T
+Sbjct: 274 EESYDLEPFLRRLGMIDAFDEAKADFSGMSTEKNVPLSKVAHKCFVEVNEEGTEAAAATA 333
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V+ + + S    +F ADHPFLF I+ + TN I++ GR+ SP
+Sbjct: 334 VVRNSRCSRMEPRFCADHPFLFFIRRHKTNCILFCGRFSSP 374
+
+
+>gb|EAW55099.1| serpin peptidase inhibitor, clade B (ovalbumin), member 6, isoform
+           CRA_b [Homo sapiens]
+ gb|EAW55100.1| serpin peptidase inhibitor, clade B (ovalbumin), member 6, isoform
+           CRA_b [Homo sapiens]
+ gb|EAW55105.1| serpin peptidase inhibitor, clade B (ovalbumin), member 6, isoform
+           CRA_b [Homo sapiens]
+          Length = 213
+
+ Score =  140 bits (352), Expect = 3e-032
+ Identities = 69/161 (42%), Positives = 110/161 (68%), Gaps = 2/161 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +IL LP+   +L+M+++LPDE +DL  +EK + +EK  EWT  + M++  V+V LP+ K+
+Sbjct: 54  QILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKL 113
+
+Query: 63  EEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y++ SVL  LGMTD F +  A+ +G+S  + L +S+ VH +F+E++E+G E A +T
+Sbjct: 114 EESYDMESVLRNLGMTDAFELGKADFSGMSQTD-LSLSKVVHKSFVEVNEEGTEAAAATA 172
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            I  ++ +    +F ADHPFLF I+H+ TN I++ GR+ SP
+Sbjct: 173 AIMMMRCARFVPRFCADHPFLFFIQHSKTNGILFCGRFSSP 213
+
+
+>gb|EAW55102.1| serpin peptidase inhibitor, clade B (ovalbumin), member 6, isoform
+           CRA_d [Homo sapiens]
+ gb|EAW55103.1| serpin peptidase inhibitor, clade B (ovalbumin), member 6, isoform
+           CRA_d [Homo sapiens]
+          Length = 380
+
+ Score =  140 bits (352), Expect = 3e-032
+ Identities = 69/161 (42%), Positives = 110/161 (68%), Gaps = 2/161 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +IL LP+   +L+M+++LPDE +DL  +EK + +EK  EWT  + M++  V+V LP+ K+
+Sbjct: 221 QILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKL 280
+
+Query: 63  EEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y++ SVL  LGMTD F +  A+ +G+S  + L +S+ VH +F+E++E+G E A +T
+Sbjct: 281 EESYDMESVLRNLGMTDAFELGKADFSGMSQTD-LSLSKVVHKSFVEVNEEGTEAAAATA 339
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            I  ++ +    +F ADHPFLF I+H+ TN I++ GR+ SP
+Sbjct: 340 AIMMMRCARFVPRFCADHPFLFFIQHSKTNGILFCGRFSSP 380
+
+
+>gb|EAW55106.1| serpin peptidase inhibitor, clade B (ovalbumin), member 6, isoform
+           CRA_f [Homo sapiens]
+          Length = 409
+
+ Score =  140 bits (352), Expect = 3e-032
+ Identities = 69/161 (42%), Positives = 110/161 (68%), Gaps = 2/161 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +IL LP+   +L+M+++LPDE +DL  +EK + +EK  EWT  + M++  V+V LP+ K+
+Sbjct: 250 QILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKL 309
+
+Query: 63  EEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y++ SVL  LGMTD F +  A+ +G+S  + L +S+ VH +F+E++E+G E A +T
+Sbjct: 310 EESYDMESVLRNLGMTDAFELGKADFSGMSQTD-LSLSKVVHKSFVEVNEEGTEAAAATA 368
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            I  ++ +    +F ADHPFLF I+H+ TN I++ GR+ SP
+Sbjct: 369 AIMMMRCARFVPRFCADHPFLFFIQHSKTNGILFCGRFSSP 409
+
+
+>gb|EAW55101.1| serpin peptidase inhibitor, clade B (ovalbumin), member 6, isoform
+           CRA_c [Homo sapiens]
+          Length = 390
+
+ Score =  140 bits (352), Expect = 3e-032
+ Identities = 69/161 (42%), Positives = 110/161 (68%), Gaps = 2/161 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +IL LP+   +L+M+++LPDE +DL  +EK + +EK  EWT  + M++  V+V LP+ K+
+Sbjct: 231 QILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKL 290
+
+Query: 63  EEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y++ SVL  LGMTD F +  A+ +G+S  + L +S+ VH +F+E++E+G E A +T
+Sbjct: 291 EESYDMESVLRNLGMTDAFELGKADFSGMSQTD-LSLSKVVHKSFVEVNEEGTEAAAATA 349
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            I  ++ +    +F ADHPFLF I+H+ TN I++ GR+ SP
+Sbjct: 350 AIMMMRCARFVPRFCADHPFLFFIQHSKTNGILFCGRFSSP 390
+
+
+>gb|EAW55104.1| serpin peptidase inhibitor, clade B (ovalbumin), member 6, isoform
+           CRA_e [Homo sapiens]
+          Length = 395
+
+ Score =  140 bits (352), Expect = 3e-032
+ Identities = 69/161 (42%), Positives = 110/161 (68%), Gaps = 2/161 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +IL LP+   +L+M+++LPDE +DL  +EK + +EK  EWT  + M++  V+V LP+ K+
+Sbjct: 236 QILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKL 295
+
+Query: 63  EEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y++ SVL  LGMTD F +  A+ +G+S  + L +S+ VH +F+E++E+G E A +T
+Sbjct: 296 EESYDMESVLRNLGMTDAFELGKADFSGMSQTD-LSLSKVVHKSFVEVNEEGTEAAAATA 354
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            I  ++ +    +F ADHPFLF I+H+ TN I++ GR+ SP
+Sbjct: 355 AIMMMRCARFVPRFCADHPFLFFIQHSKTNGILFCGRFSSP 395
+
+
+>emb|CAD98106.1| hypothetical protein [Homo sapiens]
+          Length = 409
+
+ Score =  140 bits (352), Expect = 3e-032
+ Identities = 69/161 (42%), Positives = 110/161 (68%), Gaps = 2/161 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +IL LP+   +L+M+++LPDE +DL  +EK + +EK  EWT  + M++  V+V LP+ K+
+Sbjct: 250 QILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKL 309
+
+Query: 63  EEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y++ SVL  LGMTD F +  A+ +G+S  + L +S+ VH +F+E++E+G E A +T
+Sbjct: 310 EESYDMESVLRNLGMTDAFELGKADFSGMSQTD-LSLSKVVHKSFVEVNEEGTEAAAATA 368
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            I  ++ +    +F ADHPFLF I+H+ TN I++ GR+ SP
+Sbjct: 369 AIMMMRCARFVPRFCADHPFLFFIQHSKTNGILFCGRFSSP 409
+
+
+>ref|NP_004559.4| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 6 [Homo sapiens]
+ emb|CAI23292.1| serpin peptidase inhibitor, clade B (ovalbumin), member 6 [Homo
+           sapiens]
+ gb|AAH98564.1| SERPINB6 protein [Homo sapiens]
+ gb|EAW55097.1| serpin peptidase inhibitor, clade B (ovalbumin), member 6, isoform
+           CRA_a [Homo sapiens]
+ gb|EAW55098.1| serpin peptidase inhibitor, clade B (ovalbumin), member 6, isoform
+           CRA_a [Homo sapiens]
+          Length = 376
+
+ Score =  140 bits (352), Expect = 3e-032
+ Identities = 69/161 (42%), Positives = 110/161 (68%), Gaps = 2/161 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +IL LP+   +L+M+++LPDE +DL  +EK + +EK  EWT  + M++  V+V LP+ K+
+Sbjct: 217 QILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKL 276
+
+Query: 63  EEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y++ SVL  LGMTD F +  A+ +G+S  + L +S+ VH +F+E++E+G E A +T
+Sbjct: 277 EESYDMESVLRNLGMTDAFELGKADFSGMSQTD-LSLSKVVHKSFVEVNEEGTEAAAATA 335
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            I  ++ +    +F ADHPFLF I+H+ TN I++ GR+ SP
+Sbjct: 336 AIMMMRCARFVPRFCADHPFLFFIQHSKTNGILFCGRFSSP 376
+
+
+>gb|AAO15303.1|AF116727_1 MSTP057 [Homo sapiens]
+          Length = 259
+
+ Score =  140 bits (352), Expect = 3e-032
+ Identities = 69/161 (42%), Positives = 110/161 (68%), Gaps = 2/161 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +IL LP+   +L+M+++LPDE +DL  +EK + +EK  EWT  + M++  V+V LP+ K+
+Sbjct: 100 QILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKL 159
+
+Query: 63  EEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y++ SVL  LGMTD F +  A+ +G+S  + L +S+ VH +F+E++E+G E A +T
+Sbjct: 160 EESYDMESVLRNLGMTDAFELGKADFSGMSQTD-LSLSKVVHKSFVEVNEEGTEAAAATA 218
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            I  ++ +    +F ADHPFLF I+H+ TN I++ GR+ SP
+Sbjct: 219 AIMMMRCARFVPRFCADHPFLFFIQHSKTNGILFCGRFSSP 259
+
+
+>ref|XP_541073.2| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B (ovalbumin), member 11 [Canis familiaris]
+          Length = 397
+
+ Score =  140 bits (352), Expect = 3e-032
+ Identities = 69/163 (42%), Positives = 113/163 (69%), Gaps = 1/163 (0%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           +M++LELP+ +  LSM++LLP   + LE+IEK +N +   EWT+   M +R V+V++P+
+Sbjct: 230 QMQVLELPYVNNKLSMIILLPAGTASLEQIEKELNTKTFNEWTSSANMVEREVEVHIPRF 289
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGS 119
+           K+E KY L S+L +LGMTD+F   +A+L+GIS  + L +S+ +H ++++++E+G E A +
+Sbjct: 290 KLEIKYELKSLLNSLGMTDVFNEITADLSGISPVDGLYLSKVIHQSYVDVNEEGTEAAAA 349
+
+Query: 120 TGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           TG    +K  P   +F A+HPFLF I+ + TNTI++ G+  SP
+Sbjct: 350 TGDSFVVKRLPIRARFLANHPFLFFIRLSHTNTILFCGKLASP 392
+
+
+>sp|Q5R899|SPB6_PONPY Serpin B6
+ emb|CAH92011.1| hypothetical protein [Pongo pygmaeus]
+          Length = 376
+
+ Score =  140 bits (352), Expect = 3e-032
+ Identities = 69/161 (42%), Positives = 110/161 (68%), Gaps = 2/161 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +IL LP+   +L+M+++LPDE +DL  +EK + +EK  EWT  + M++  V+V LP+ K+
+Sbjct: 217 QILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKL 276
+
+Query: 63  EEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y++ SVL  LGMTD F +  A+ +G+S  + L +S+ VH +F+E++E+G E A +T
+Sbjct: 277 EESYDMESVLRNLGMTDAFELGKADFSGMSQTD-LSLSKVVHKSFVEVNEEGTEAAAATA 335
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            I  ++ +    +F ADHPFLF I+H+ TN I++ GR+ SP
+Sbjct: 336 AIMMMRCARFVPRFCADHPFLFFIQHSKTNGILFCGRFSSP 376
+
+
+>sp|P35237|SPB6_HUMAN Serpin B6 (Placental thrombin inhibitor) (Cytoplasmic
+           antiproteinase) (CAP) (Protease inhibitor 6) (PI-6)
+ gb|AAB30320.1| cytoplasmic antiproteinase; CAP [Homo sapiens]
+ gb|AAH01394.1| SERPINB6 protein [Homo sapiens]
+ gb|ABM86293.1| serpin peptidase inhibitor, clade B (ovalbumin), member 6
+           [synthetic construct]
+          Length = 376
+
+ Score =  140 bits (352), Expect = 3e-032
+ Identities = 69/161 (42%), Positives = 110/161 (68%), Gaps = 2/161 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +IL LP+   +L+M+++LPDE +DL  +EK + +EK  EWT  + M++  V+V LP+ K+
+Sbjct: 217 QILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKL 276
+
+Query: 63  EEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y++ SVL  LGMTD F +  A+ +G+S  + L +S+ VH +F+E++E+G E A +T
+Sbjct: 277 EESYDMESVLRNLGMTDAFELGKADFSGMSQTD-LSLSKVVHKSFVEVNEEGTEAAAATA 335
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            I  ++ +    +F ADHPFLF I+H+ TN I++ GR+ SP
+Sbjct: 336 AIMMMRCARFVPRFCADHPFLFFIQHSKTNGILFCGRFSSP 376
+
+
+>sp|Q8K3K4|SPB10_RAT Serpin B10 (Transforming growth factor beta repressible serpin)
+           (TGF-beta-repressible serine proteinase inhibitor)
+           (Trespin)
+ gb|AAL78042.1| transforming growth factor beta repressible serpin [Rattus
+           norvegicus]
+          Length = 397
+
+ Score =  140 bits (352), Expect = 3e-032
+ Identities = 67/159 (42%), Positives = 107/159 (67%), Gaps = 1/159 (0%)
+
+Query: 5   LELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEE 64
+           ++L + + + S+L+LLP+EV  L+++E+ I +EKL +WT+ + M+   V++YLP+ K+EE
+Sbjct: 239 VQLHYQNREFSLLLLLPEEVEGLKQLERAITYEKLDKWTSADMMDTYEVRLYLPKFKMEE 298
+
+Query: 65  KYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVI 123
+            Y+L S L  +GMTD F    AN + ++S  +L +S   H  F+E++E+G E A  TG
+Sbjct: 299 SYDLQSALRDMGMTDAFNQGKANFSNMTSERNLFLSNVFHKTFLEINEEGTEAAAGTGSE 358
+
+Query: 124 EDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            + +    S +  ADHPFLFLI+HN TNTI++ GR++SP
+Sbjct: 359 VNFRIKAPSIELNADHPFLFLIRHNVTNTILFDGRFYSP 397
+
+
+>ref|XP_001365843.1| PREDICTED: similar to plasminogen activator inhibitor [Monodelphis
+           domestica]
+          Length = 416
+
+ Score =  139 bits (351), Expect = 4e-032
+ Identities = 74/167 (44%), Positives = 106/167 (63%), Gaps = 6/167 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +I+E+P+A GD+SM VLLPDE++D    LE +E+ I +EKLT W    TME   V V+
+Sbjct: 251 KSQIVEIPYA-GDISMFVLLPDEIADSSTGLELLEREITYEKLTAWIKKATMESNDVHVF 309
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ K+E+ Y   S+L ++GM D F    AN +G+S +  L +S+  H A ++++E+G E
+Sbjct: 310 LPKFKMEKNYEFKSILQSMGMNDAFSKIQANFSGMSESNDLFLSEVFHQASVDVNEEGTE 369
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A  TG +   +      Q  ADHPFLF I H  TNTI++FGR+ SP
+Sbjct: 370 AAAGTGGVMTGRTGHIGLQVVADHPFLFFIIHKKTNTILFFGRFCSP 416
+
+
+>emb|CAA80373.1| thrombin inhibitor [Homo sapiens]
+          Length = 376
+
+ Score =  139 bits (351), Expect = 4e-032
+ Identities = 69/161 (42%), Positives = 109/161 (67%), Gaps = 2/161 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +IL LP+   +L+M+++LPDE +DL  +EK + +EK  EWT  + M++  V+V LP+ K+
+Sbjct: 217 QILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKL 276
+
+Query: 63  EEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y++ SVL  LGMTD F +  A+ +G+S  + L +S+ VH +F+E++E+G E A +T
+Sbjct: 277 EESYDMESVLRNLGMTDAFELGKADFSGMSQTD-LSLSKVVHKSFVEVNEEGTEAAAATA 335
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            I  ++ +    +F ADHPFLF I+H  TN I++ GR+ SP
+Sbjct: 336 AIMMMRCARFVPRFCADHPFLFFIQHRKTNGILFCGRFSSP 376
+
+
+>ref|XP_851985.1| PREDICTED: similar to Plasminogen activator inhibitor-2 precursor
+           (PAI-2) (Placental plasminogen activator inhibitor)
+           (Monocyte Arg-serpin) (Urokinase inhibitor) [Canis
+           familiaris]
+          Length = 537
+
+ Score =  139 bits (351), Expect = 4e-032
+ Identities = 75/167 (44%), Positives = 108/167 (64%), Gaps = 6/167 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILELP+A G++SM +LLPDE++D    LE +E  I ++K  +WT+ +TM +  V+VY
+Sbjct: 370 KTQILELPYA-GNISMFLLLPDEITDVSTGLELLESEITYDKFIKWTSKDTMAEDNVEVY 428
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LPQ K+EE+Y L S+L  +GM + F  S AN +G+S+   L +SQ  H A ++++E+G E
+Sbjct: 429 LPQFKLEERYELRSILRNMGMEEAFSQSQANFSGMSNTNDLFLSQVFHQATVDVNEEGTE 488
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A  TG     +      QF ADHPFLFLI H  T +I++FGR   P
+Sbjct: 489 AAAGTGATLSGRTGHGGPQFVADHPFLFLIMHKITKSILFFGRLVLP 535
+
+
+>ref|XP_001148307.1| PREDICTED: similar to Chain A, Human Plasminogen Activator
+           Inhibitor-2. Loop (66-98) Deletion Mutant isoform 1 [Pan
+           troglodytes]
+          Length = 386
+
+ Score =  139 bits (350), Expect = 5e-032
+ Identities = 74/167 (44%), Positives = 108/167 (64%), Gaps = 6/167 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILELP+A G++SM +LLPDE++D    LE +E  I ++KL +WT+ + M +  V+VY
+Sbjct: 221 KAQILELPYA-GNVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKMAEDDVEVY 279
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           +PQ K+EE Y L S+L ++GM D F    AN +G+S    L +S+  H A ++++E+G E
+Sbjct: 280 IPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTE 339
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A  TG +   +      QF ADHPFLFLI H  T  I++FGR+ SP
+Sbjct: 340 AAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITKCILFFGRFSSP 386
+
+
+>ref|XP_001148522.1| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 2 isoform 2 [Pan troglodytes]
+ ref|XP_001148726.1| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 2 isoform 5 [Pan troglodytes]
+          Length = 415
+
+ Score =  139 bits (350), Expect = 5e-032
+ Identities = 74/167 (44%), Positives = 108/167 (64%), Gaps = 6/167 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILELP+A G++SM +LLPDE++D    LE +E  I ++KL +WT+ + M +  V+VY
+Sbjct: 250 KAQILELPYA-GNVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKMAEDDVEVY 308
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           +PQ K+EE Y L S+L ++GM D F    AN +G+S    L +S+  H A ++++E+G E
+Sbjct: 309 IPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTE 368
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A  TG +   +      QF ADHPFLFLI H  T  I++FGR+ SP
+Sbjct: 369 AAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITKCILFFGRFSSP 415
+
+
+>ref|XP_848373.1| PREDICTED: similar to Placental thrombin inhibitor (Cytoplasmic
+           antiproteinase) (CAP) (Protease inhibitor 6) (PI-6)
+           (Serpin B6) isoform 2 [Canis familiaris]
+          Length = 381
+
+ Score =  139 bits (350), Expect = 5e-032
+ Identities = 65/161 (40%), Positives = 112/161 (69%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KIL LP+   +L+M+++LPDE   LE +E  + +EK TEWT P+ +++  V+V+LP+ K+
+Sbjct: 221 KILVLPYVGRELNMIIMLPDENVSLETVETELTYEKFTEWTRPDMLDEEEVEVFLPRFKL 280
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE+Y++ +VL +LGMTD F  S A+ +G+SS   L +S+ VH +F+E++E+G E A ++
+Sbjct: 281 EEEYDMKAVLCSLGMTDAFEQSKADFSGMSSRGDLYLSKVVHKSFVEVNEEGTEAAAASA 340
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            +  ++ +    +F AD PFLF I+H+ + ++++ GR+ SP
+Sbjct: 341 AVMMLRCARIVPRFCADRPFLFFIQHSKSRSVLFCGRFSSP 381
+
+
+>ref|XP_855911.1| PREDICTED: similar to Placental thrombin inhibitor (Cytoplasmic
+           antiproteinase) (CAP) (Protease inhibitor 6) (PI-6)
+           (Serpin B6) isoform 3 [Canis familiaris]
+          Length = 345
+
+ Score =  139 bits (350), Expect = 5e-032
+ Identities = 65/161 (40%), Positives = 112/161 (69%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KIL LP+   +L+M+++LPDE   LE +E  + +EK TEWT P+ +++  V+V+LP+ K+
+Sbjct: 185 KILVLPYVGRELNMIIMLPDENVSLETVETELTYEKFTEWTRPDMLDEEEVEVFLPRFKL 244
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE+Y++ +VL +LGMTD F  S A+ +G+SS   L +S+ VH +F+E++E+G E A ++
+Sbjct: 245 EEEYDMKAVLCSLGMTDAFEQSKADFSGMSSRGDLYLSKVVHKSFVEVNEEGTEAAAASA 304
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            +  ++ +    +F AD PFLF I+H+ + ++++ GR+ SP
+Sbjct: 305 AVMMLRCARIVPRFCADRPFLFFIQHSKSRSVLFCGRFSSP 345
+
+
+>ref|XP_001376126.1| PREDICTED: similar to bomapin [Monodelphis domestica]
+          Length = 470
+
+ Score =  139 bits (349), Expect = 6e-032
+ Identities = 67/163 (41%), Positives = 111/163 (68%), Gaps = 3/163 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFE--KLTEWTNPNTMEKRRVKVYLPQM 60
+           K ++L + +GD+SM +LLPD+++ L+ ++K  N    KL++WT+ + MEK  V++YLP+
+Sbjct: 308 KGIQLYYGNGDMSMFILLPDDINGLKEVKKKSNITSGKLSDWTHEDMMEKYDVQLYLPKF 367
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGS 119
+           K+EE Y+L S+L ++GM+D F  S A+ +G++  ++L +S+  H AF+E++E+G E A S
+Sbjct: 368 KLEENYDLKSILSSMGMSDAFSTSHADFSGMTEMKNLFLSEVFHKAFVEVNEEGTEAAAS 427
+
+Query: 120 TGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           T     ++    S  F  DHPFLF IKH  TN I+++G+ +SP
+Sbjct: 428 TAEDFSVRMKLPSLTFNVDHPFLFFIKHKKTNCILFYGKVYSP 470
+
+
+>ref|XP_225268.2| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B, member 1a [Rattus norvegicus]
+ ref|XP_001066387.1| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B, member 1a [Rattus norvegicus]
+          Length = 387
+
+ Score =  138 bits (348), Expect = 8e-032
+ Identities = 76/168 (45%), Positives = 113/168 (67%), Gaps = 8/168 (4%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K K+LE+P+  G+LSM++LLP+++ D    L++IE+ +  EKL EWT    +++  V V
+Sbjct: 222 KCKVLEMPYQGGELSMVILLPEDIEDESTGLQKIEEQLTLEKLYEWTKHENLKEIDVHVN 281
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ KIEE Y L S L  LG+ DLF  S A+L+G+S +  + IS+ VH +F+E++E+G E
+Sbjct: 282 LPKFKIEESYILNSNLGRLGLQDLFSSSKADLSGMSESRDIFISKIVHKSFVEVNEEGTE 341
+
+Query: 116 MAGST-GVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +T G++E    S E+  F  DHPFLF I+HNPT  +++FGR  SP
+Sbjct: 342 AAAATAGLVEYCLVSIEA--FIVDHPFLFFIRHNPTANMLFFGRVCSP 387
+
+
+>gb|AAH94073.1| MGC115155 protein [Xenopus laevis]
+          Length = 377
+
+ Score =  138 bits (348), Expect = 8e-032
+ Identities = 72/165 (43%), Positives = 113/165 (68%), Gaps = 8/165 (4%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVYLP 58
+           +ILELP+   +LSM+++LPD ++D    L+++EK ++ EK+ EWT    M    V ++LP
+Sbjct: 216 RILELPYVDYELSMIIILPDNINDDTTGLQQLEKELSLEKIHEWTE--NMMPTDVHIHLP 273
+
+Query: 59  QMKIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMA 117
+           + K+E+ Y L S L  +GM DLF   SA+L+G+S + +L +S+ +H +F+E++E+G E A
+Sbjct: 274 KFKLEDSYKLKSQLAGMGMVDLFNSGSADLSGMSGSNNLFLSEVIHKSFVEVNEEGTEAA 333
+
+Query: 118 GSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            ++  I  +    E E+F ADHPFLFLI+HN T +I++FGRY SP
+Sbjct: 334 AASAGIAMMCMMRE-EEFNADHPFLFLIRHNATKSILFFGRYSSP 377
+
+
+>ref|XP_001159818.1| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 9 isoform 1 [Pan troglodytes]
+          Length = 354
+
+ Score =  138 bits (347), Expect = 1e-031
+ Identities = 71/164 (43%), Positives = 111/164 (67%), Gaps = 2/164 (1%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           + ++LELP+A  +LS+LVLLPD+  +L  +EK++ FEKLT WT P+ M+   V+V LP+
+Sbjct: 191 RAQLLELPYAGKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKF 250
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGS 119
+           K++E Y++ SVL  LG+ D F    A+L+ +S+   L +S+ VH +F+E++E+G E A +
+Sbjct: 251 KLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAA 310
+
+Query: 120 TGVIEDIKHSPES-EQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +      +   ES  +F ADHPFLF I+HN  N+I++ GR+ SP
+Sbjct: 311 SSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP 354
+
+
+>ref|XP_001160054.1| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 9 isoform 3 [Pan troglodytes]
+          Length = 376
+
+ Score =  138 bits (347), Expect = 1e-031
+ Identities = 71/164 (43%), Positives = 111/164 (67%), Gaps = 2/164 (1%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           + ++LELP+A  +LS+LVLLPD+  +L  +EK++ FEKLT WT P+ M+   V+V LP+
+Sbjct: 213 RAQLLELPYAGKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKF 272
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGS 119
+           K++E Y++ SVL  LG+ D F    A+L+ +S+   L +S+ VH +F+E++E+G E A +
+Sbjct: 273 KLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAA 332
+
+Query: 120 TGVIEDIKHSPES-EQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +      +   ES  +F ADHPFLF I+HN  N+I++ GR+ SP
+Sbjct: 333 SSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP 376
+
+
+>ref|NP_954516.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 6 [Rattus norvegicus]
+ gb|AAH60594.1| Serine (or cysteine) peptidase inhibitor, clade B, member 6a
+           [Rattus norvegicus]
+          Length = 379
+
+ Score =  138 bits (347), Expect = 1e-031
+ Identities = 67/161 (41%), Positives = 109/161 (67%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KIL LP+A  +L+M+++LPDE  +L+ +EK + +EK  EWT  + +++  V+V+LP+ K+
+Sbjct: 219 KILLLPYAGNELNMIIMLPDEHIELKTVEKELTYEKFIEWTRLDMLDEEEVEVFLPRFKL 278
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y++  VL  LGMTD F+   A+ +GI+S + L +S+ +H AF+E++E+G E   +TG
+Sbjct: 279 EENYDMKVVLGKLGMTDAFMEGRADFSGIASKQGLFLSKVIHKAFVEVNEEGTEAVAATG 338
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+               ++    + +F ADHPFLF I+H  T  I++ GR+ SP
+Sbjct: 339 STITMRCLRFTPRFLADHPFLFFIQHVKTKGILFCGRFSSP 379
+
+
+>ref|NP_956230.1| serpin peptidase inhibitor, clade B (ovalbumin), member 1, like 3
+           [Danio rerio]
+ gb|AAH53300.1| Serpin peptidase inhibitor, clade B (ovalbumin), member 1, like 3
+           [Danio rerio]
+          Length = 380
+
+ Score =  138 bits (347), Expect = 1e-031
+ Identities = 68/165 (41%), Positives = 110/165 (66%), Gaps = 5/165 (3%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVYLP 58
+           +ILELP+A  +LSMLVLLP+ + D    LE++E+ +  E LT+WT  + M+   V+V LP
+Sbjct: 216 QILELPYAGKELSMLVLLPNAMEDDGTGLEKLERALTLETLTDWTRSDMMDVLEVEVSLP 275
+
+Query: 59  QMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMA 117
+           ++++EE+  L  +L+ LGM D F P  A+ +G+ +   L +S  VH +F+E++E+G E A
+Sbjct: 276 RLRVEERLELKPLLVELGMPDAFDPQRADFSGVCAGGELLLSTVVHQSFLEVNEEGTEAA 335
+
+Query: 118 GSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            +T  +   +    +E+F ADHPFL LI+HNPT +++++GR  +P
+Sbjct: 336 AATAAVMMTRCLMRAERFCADHPFLMLIRHNPTGSLLFYGRVCNP 380
+
+
+>ref|NP_777214.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 6 [Bos taurus]
+ sp|O02739|SPB6_BOVIN Serpin B6 (Serine proteinase inhibitor B-43)
+ dbj|BAA19875.1| thrombin inhibitor [Bos taurus]
+          Length = 378
+
+ Score =  138 bits (347), Expect = 1e-031
+ Identities = 64/161 (39%), Positives = 106/161 (65%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +IL LP+   +L+M++LLP E +DL  +EK + +EK   WT P+ M++  V+V+LP+  +
+Sbjct: 218 QILVLPYVGQELNMVILLPSESTDLNTVEKALTYEKFIAWTKPDVMDEEEVEVFLPRFTL 277
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y++   L  LGMTD F  + A+ +G+SS   L +S+ +H +F+E++E+G E A +TG
+Sbjct: 278 EESYDMEEFLQELGMTDAFEETRADFSGMSSGRGLHLSKVMHKSFVEVTEEGTEAAAATG 337
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            +  ++      +F A+HPFLF I+H+ T  I++ GR+ SP
+Sbjct: 338 AVVMMRCLMVVPRFNANHPFLFFIQHSKTGAILFCGRFCSP 378
+
+
+>emb|CAE45712.1| hypothetical protein [Homo sapiens]
+          Length = 180
+
+ Score =  137 bits (346), Expect = 1e-031
+ Identities = 71/164 (43%), Positives = 111/164 (67%), Gaps = 2/164 (1%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           + ++LELP+A  +LS+LVLLPD+  +L  +EK++ FEKLT WT P+ M+   V+V LP+
+Sbjct: 17  RAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKF 76
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGS 119
+           K++E Y++ SVL  LG+ D F    A+L+ +S+   L +S+ VH +F+E++E+G E A +
+Sbjct: 77  KLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAA 136
+
+Query: 120 TGVIEDIKHSPES-EQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +      +   ES  +F ADHPFLF I+HN  N+I++ GR+ SP
+Sbjct: 137 SSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP 180
+
+
+>gb|AAP36700.1| Homo sapiens serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 9 [synthetic construct]
+ gb|AAX43752.1| serine or cysteine proteinase inhibitor clade B member 9 [synthetic
+           construct]
+ gb|AAX43753.1| serine or cysteine proteinase inhibitor clade B member 9 [synthetic
+           construct]
+          Length = 377
+
+ Score =  137 bits (346), Expect = 1e-031
+ Identities = 71/164 (43%), Positives = 111/164 (67%), Gaps = 2/164 (1%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           + ++LELP+A  +LS+LVLLPD+  +L  +EK++ FEKLT WT P+ M+   V+V LP+
+Sbjct: 213 RAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKF 272
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGS 119
+           K++E Y++ SVL  LG+ D F    A+L+ +S+   L +S+ VH +F+E++E+G E A +
+Sbjct: 273 KLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAA 332
+
+Query: 120 TGVIEDIKHSPES-EQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +      +   ES  +F ADHPFLF I+HN  N+I++ GR+ SP
+Sbjct: 333 SSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP 376
+
+
+>ref|NP_004146.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 9 [Homo sapiens]
+ sp|P50453|SPB9_HUMAN Serpin B9 (Cytoplasmic antiproteinase 3) (CAP-3) (CAP3) (Protease
+           inhibitor 9)
+ gb|AAC41940.1| cytoplasmic antiproteinase 3
+ gb|AAC50793.1| serine proteinase inhibitor [Homo sapiens]
+ gb|AAH02538.1| Serpin peptidase inhibitor, clade B (ovalbumin), member 9 [Homo
+           sapiens]
+ dbj|BAB91078.1| serine protease inhibitor 9 [Homo sapiens]
+ gb|AAP35319.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 9 [Homo sapiens]
+ emb|CAG28555.1| SERPINB9 [Homo sapiens]
+ emb|CAI23290.1| serpin peptidase inhibitor, clade B (ovalbumin), member 9 [Homo
+           sapiens]
+ gb|AAX32127.1| serine or cysteine proteinase inhibitor clade B member 9 [synthetic
+           construct]
+ gb|AAX32128.1| serine or cysteine proteinase inhibitor clade B member 9 [synthetic
+           construct]
+ gb|EAW55093.1| serpin peptidase inhibitor, clade B (ovalbumin), member 9, isoform
+           CRA_a [Homo sapiens]
+ gb|EAW55094.1| serpin peptidase inhibitor, clade B (ovalbumin), member 9, isoform
+           CRA_a [Homo sapiens]
+ gb|EAW55095.1| serpin peptidase inhibitor, clade B (ovalbumin), member 9, isoform
+           CRA_a [Homo sapiens]
+ gb|ABM81700.1| serpin peptidase inhibitor, clade B (ovalbumin), member 9
+           [synthetic construct]
+ gb|ABM84860.1| serpin peptidase inhibitor, clade B (ovalbumin), member 9
+           [synthetic construct]
+          Length = 376
+
+ Score =  137 bits (346), Expect = 1e-031
+ Identities = 71/164 (43%), Positives = 111/164 (67%), Gaps = 2/164 (1%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           + ++LELP+A  +LS+LVLLPD+  +L  +EK++ FEKLT WT P+ M+   V+V LP+
+Sbjct: 213 RAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKF 272
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGS 119
+           K++E Y++ SVL  LG+ D F    A+L+ +S+   L +S+ VH +F+E++E+G E A +
+Sbjct: 273 KLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAA 332
+
+Query: 120 TGVIEDIKHSPES-EQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +      +   ES  +F ADHPFLF I+HN  N+I++ GR+ SP
+Sbjct: 333 SSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP 376
+
+
+>ref|XP_222499.4| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B (ovalbumin), member 12 [Rattus norvegicus]
+ ref|XP_001056564.1| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B (ovalbumin), member 12 [Rattus norvegicus]
+          Length = 421
+
+ Score =  137 bits (345), Expect = 2e-031
+ Identities = 71/165 (43%), Positives = 106/165 (64%), Gaps = 5/165 (3%)
+
+Query: 3   KILELPFASGDLSMLVLLP----DEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLP 58
+           +ILE+ + +G LSMLVLLP    D V  L+ +EK IN EKL  W+NP  M ++ V +  P
+Sbjct: 257 QILEMKYTTGKLSMLVLLPSSSEDNVKSLQELEKKINHEKLLAWSNPENMSEKPVAISFP 316
+
+Query: 59  QMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMA 117
+           Q  +E+ Y+L SVL  +G+ D+F  + A+LTGIS + SL +S+ VH  F+E+ E G + A
+Sbjct: 317 QFIMEDSYDLNSVLQDMGIRDVFDGTKADLTGISKSPSLHLSKVVHKTFVEVDEMGTQAA 376
+
+Query: 118 GSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            ++G +   K  P   +F A+ PFLF I+HN T ++++ GR +SP
+Sbjct: 377 AASGAVVAEKALPSRVEFNANRPFLFFIRHNGTQSLLFCGRVYSP 421
+
+
+>ref|XP_989175.1| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B (ovalbumin), member 12 isoform 1 [Mus musculus]
+          Length = 419
+
+ Score =  137 bits (345), Expect = 2e-031
+ Identities = 69/165 (41%), Positives = 108/165 (65%), Gaps = 5/165 (3%)
+
+Query: 3   KILELPFASGDLSMLVLLP----DEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLP 58
+           +ILE+ +A G LSMLVLLP    D V+ L+ +EK IN EKL  W++   + ++ V +  P
+Sbjct: 255 QILEMKYAMGKLSMLVLLPSCSEDNVNSLQELEKKINHEKLLAWSSSENLSEKPVAISFP 314
+
+Query: 59  QMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMA 117
+           Q  +E+ Y+L S+L  +G+ D+F  + A+LTGIS + +L +S+ VH  F+E+ E G + A
+Sbjct: 315 QFNLEDSYDLKSILQDMGIKDVFDETKADLTGISKSPNLYLSKIVHKTFVEVDEMGTQAA 374
+
+Query: 118 GSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            ++GV+   K  P   +F A+HPFLF I+HNPT ++++ GR + P
+Sbjct: 375 AASGVVAAEKALPSWVEFNANHPFLFFIRHNPTQSLLFCGRVYCP 419
+
+
+>ref|XP_989203.1| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B (ovalbumin), member 12 isoform 2 [Mus musculus]
+ ref|XP_989233.1| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B (ovalbumin), member 12 isoform 3 [Mus musculus]
+          Length = 292
+
+ Score =  137 bits (345), Expect = 2e-031
+ Identities = 69/165 (41%), Positives = 108/165 (65%), Gaps = 5/165 (3%)
+
+Query: 3   KILELPFASGDLSMLVLLP----DEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLP 58
+           +ILE+ +A G LSMLVLLP    D V+ L+ +EK IN EKL  W++   + ++ V +  P
+Sbjct: 128 QILEMKYAMGKLSMLVLLPSCSEDNVNSLQELEKKINHEKLLAWSSSENLSEKPVAISFP 187
+
+Query: 59  QMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMA 117
+           Q  +E+ Y+L S+L  +G+ D+F  + A+LTGIS + +L +S+ VH  F+E+ E G + A
+Sbjct: 188 QFNLEDSYDLKSILQDMGIKDVFDETKADLTGISKSPNLYLSKIVHKTFVEVDEMGTQAA 247
+
+Query: 118 GSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            ++GV+   K  P   +F A+HPFLF I+HNPT ++++ GR + P
+Sbjct: 248 AASGVVAAEKALPSWVEFNANHPFLFFIRHNPTQSLLFCGRVYCP 292
+
+
+>ref|NP_033152.2| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 3A [Mus musculus]
+ gb|AAN62870.1| squamous cell carcinoma antigen 2 [Mus musculus]
+ gb|AAN62871.1| squamous cell carcinoma antigen 2 [Mus musculus]
+ gb|AAH63756.1| Serine (or cysteine) peptidase inhibitor, clade B (ovalbumin),
+           member 3A [Mus musculus]
+          Length = 387
+
+ Score =  137 bits (345), Expect = 2e-031
+ Identities = 67/161 (41%), Positives = 106/161 (65%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KI+E+P+   +LSM+VLLP E++ L+++E+ +  +KL EWT    M    + + LP+ K+
+Sbjct: 227 KIVEIPYKGKELSMIVLLPVEINGLKQLEEQLTADKLLEWTRAENMHMTELYLSLPRFKV 286
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           +EKY+L   L  +GM D F P  A+ +G+SS + L +S+ +H +F+E++E+G E A +TG
+Sbjct: 287 DEKYDLPIPLEHMGMVDAFDPQKADFSGMSSTQGLVVSKVLHKSFVEVNEEGTEAAAATG 346
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V   +  +  +E F  DHPFLF I H  TN+I++FGR  SP
+Sbjct: 347 VEVSLTSAQIAEDFCCDHPFLFFIIHRKTNSILFFGRISSP 387
+
+
+>gb|AAH50060.1| Serine (or cysteine) peptidase inhibitor, clade B, member 9e [Mus
+           musculus]
+          Length = 377
+
+ Score =  137 bits (345), Expect = 2e-031
+ Identities = 69/162 (42%), Positives = 108/162 (66%), Gaps = 2/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           ++L +P+   DL+ +VLLPD+  D+ ++E  + FEKLT WT P  M +  + VYLP+ K+
+Sbjct: 216 QVLVMPYEGIDLNFVVLLPDQGVDISKVENNLTFEKLTAWTKPEFMNRTELHVYLPKFKL 275
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE-MAGST 120
+           +E Y++ S+L  LG+ D+F  S A+ +G+S+ E+L +S+ VH   +E++E+G E +A S
+Sbjct: 276 QEDYDMNSLLQHLGILDVFNGSKADFSGMSTKENLCLSKFVHKCVVEVNEEGTEAVAASA 335
+
+Query: 121 GVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           G I      P+ E F ADHPFLF I H+ TN+I++ GR+ SP
+Sbjct: 336 GKIILFCDGPDPEVFCADHPFLFFIMHSTTNSILFCGRFTSP 377
+
+
+>gb|AAR89287.1| serpinb12 [Mus musculus]
+          Length = 423
+
+ Score =  137 bits (345), Expect = 2e-031
+ Identities = 69/165 (41%), Positives = 108/165 (65%), Gaps = 5/165 (3%)
+
+Query: 3   KILELPFASGDLSMLVLLP----DEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLP 58
+           +ILE+ +A G LSMLVLLP    D V+ L+ +EK IN EKL  W++   + ++ V +  P
+Sbjct: 259 QILEMKYAMGKLSMLVLLPSCSEDNVNSLQELEKKINHEKLLAWSSSENLSEKPVAISFP 318
+
+Query: 59  QMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMA 117
+           Q  +E+ Y+L S+L  +G+ D+F  + A+LTGIS + +L +S+ VH  F+E+ E G + A
+Sbjct: 319 QFNLEDSYDLKSILQDMGIKDVFDETKADLTGISKSPNLYLSKIVHKTFVEVDEMGTQAA 378
+
+Query: 118 GSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            ++GV+   K  P   +F A+HPFLF I+HNPT ++++ GR + P
+Sbjct: 379 AASGVVAAEKALPSWVEFNANHPFLFFIRHNPTQSLLFCGRVYCP 423
+
+
+>ref|NP_082247.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 12 [Mus musculus]
+ sp|Q9D7P9|SPB12_MOUSE Serpin B12
+ dbj|BAB26028.1| unnamed protein product [Mus musculus]
+ dbj|BAC30672.1| unnamed protein product [Mus musculus]
+ gb|AAH62134.1| Serine (or cysteine) peptidase inhibitor, clade B (ovalbumin),
+           member 12 [Mus musculus]
+          Length = 423
+
+ Score =  137 bits (345), Expect = 2e-031
+ Identities = 69/165 (41%), Positives = 108/165 (65%), Gaps = 5/165 (3%)
+
+Query: 3   KILELPFASGDLSMLVLLP----DEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLP 58
+           +ILE+ +A G LSMLVLLP    D V+ L+ +EK IN EKL  W++   + ++ V +  P
+Sbjct: 259 QILEMKYAMGKLSMLVLLPSCSEDNVNSLQELEKKINHEKLLAWSSSENLSEKPVAISFP 318
+
+Query: 59  QMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMA 117
+           Q  +E+ Y+L S+L  +G+ D+F  + A+LTGIS + +L +S+ VH  F+E+ E G + A
+Sbjct: 319 QFNLEDSYDLKSILQDMGIKDVFDETKADLTGISKSPNLYLSKIVHKTFVEVDEMGTQAA 378
+
+Query: 118 GSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            ++GV+   K  P   +F A+HPFLF I+HNPT ++++ GR + P
+Sbjct: 379 AASGVVAAEKALPSWVEFNANHPFLFFIRHNPTQSLLFCGRVYCP 423
+
+
+>ref|NP_035586.1| serine (or cysteine) proteinase inhibitor, clade B, member 9e [Mus
+           musculus]
+ gb|AAB57821.2| NK26 [Mus musculus]
+ dbj|BAC33749.1| unnamed protein product [Mus musculus]
+ emb|CAI25620.1| serine protease inhibitor 14 [Mus musculus]
+          Length = 377
+
+ Score =  137 bits (344), Expect = 2e-031
+ Identities = 69/162 (42%), Positives = 108/162 (66%), Gaps = 2/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           ++L +P+   DL+ +VLLPD+  D+ ++E  + FEKLT WT P  M +  + VYLP+ K+
+Sbjct: 216 QVLVMPYEGIDLNFVVLLPDQGVDISKVENNLTFEKLTAWTKPEFMNRTELHVYLPKFKL 275
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE-MAGST 120
+           +E Y++ S+L  LG+ D+F  S A+ +G+S+ E+L +S+ VH   +E++E+G E +A S
+Sbjct: 276 QEDYDMNSLLQHLGILDVFNGSKADFSGMSTKENLCLSKFVHKCVVEVNEEGTEAVAASA 335
+
+Query: 121 GVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           G I      P+ E F ADHPFLF I H+ TN+I++ GR+ SP
+Sbjct: 336 GKIILFCDGPDPEVFCADHPFLFFIMHSTTNSILFCGRFSSP 377
+
+
+>ref|NP_932145.2| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 10 [Mus musculus]
+          Length = 397
+
+ Score =  137 bits (344), Expect = 2e-031
+ Identities = 65/159 (40%), Positives = 105/159 (66%), Gaps = 1/159 (0%)
+
+Query: 5   LELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEE 64
+           L+L + + DLS+L+LLP+ +  LE++E+ I +EKL +WT+ + M+   V++YLP+ K+EE
+Sbjct: 239 LQLHYQNRDLSLLLLLPEAIDGLEQLERAITYEKLDKWTSADMMDTYEVQLYLPKFKMEE 298
+
+Query: 65  KYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVI 123
+            Y+L S L  +GMTD+F  S A+ + ++S  +L +S   H  F+E++E+G E A  TG
+Sbjct: 299 SYDLKSALRGMGMTDVFSQSKADFSNMTSERNLFLSNVFHKTFLEINEEGTEAAAGTGSE 358
+
+Query: 124 EDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+             ++    S +   DHPFLF I+HN T +I++ GR+ SP
+Sbjct: 359 ISVRIKAPSIELNVDHPFLFFIRHNKTKSILFCGRFCSP 397
+
+
+>ref|NP_001007733.1| similar to SPI6 [Rattus norvegicus]
+ gb|AAH79063.1| Similar to SPI6 [Rattus norvegicus]
+          Length = 374
+
+ Score =  137 bits (344), Expect = 2e-031
+ Identities = 69/161 (42%), Positives = 108/161 (67%), Gaps = 2/161 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           ++L +P+   +LS +VLLPD   DL ++E  + FEKLT WTNP+ M+   V+V+LP+ K+
+Sbjct: 215 QVLMMPYEGMELSFVVLLPDNDGDLSKVESNLTFEKLTAWTNPDFMKNTNVEVFLPKFKL 274
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           +E Y++ SV   LG+ D+F  + A+L+ +S   +L +S+ VH + +E++E+G E A ++
+Sbjct: 275 QEDYDMESVFQRLGIVDVFQEAKADLSAMSPERNLCVSKIVHKSLVEVNEEGTEAAAASA 334
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           VIE    +     F ADHPFLF IKHN TN+I++ GR+ SP
+Sbjct: 335 VIE-YCCAAFVPTFCADHPFLFFIKHNKTNSILFCGRFSSP 374
+
+
+>sp|Q8K1K6|SPB10_MOUSE Serpin B10
+ gb|AAH29736.1| Serine (or cysteine) peptidase inhibitor, clade B (ovalbumin),
+           member 10 [Mus musculus]
+ gb|AAH69938.1| Serine (or cysteine) peptidase inhibitor, clade B (ovalbumin),
+           member 10 [Mus musculus]
+          Length = 397
+
+ Score =  137 bits (344), Expect = 2e-031
+ Identities = 65/159 (40%), Positives = 105/159 (66%), Gaps = 1/159 (0%)
+
+Query: 5   LELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEE 64
+           L+L + + DLS+L+LLP+ +  LE++E+ I +EKL +WT+ + M+   V++YLP+ K+EE
+Sbjct: 239 LQLHYQNRDLSLLLLLPEAIDGLEQLERAITYEKLDKWTSADMMDTYEVQLYLPKFKMEE 298
+
+Query: 65  KYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVI 123
+            Y+L S L  +GMTD+F  S A+ + ++S  +L +S   H  F+E++E+G E A  TG
+Sbjct: 299 SYDLKSALRGMGMTDVFSQSKADFSNMTSERNLFLSNVFHKTFLEINEEGTEAAAGTGSE 358
+
+Query: 124 EDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+             ++    S +   DHPFLF I+HN T +I++ GR+ SP
+Sbjct: 359 ISVRIKAPSIELNVDHPFLFFIRHNKTKSILFCGRFCSP 397
+
+
+>gb|AAH74408.1| MGC84405 protein [Xenopus laevis]
+          Length = 383
+
+ Score =  136 bits (342), Expect = 4e-031
+ Identities = 69/167 (41%), Positives = 106/167 (63%), Gaps = 9/167 (5%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K  +LELPF S  LS+L+LLP ++ D    L+++E+ + FEK  +WTNP+ M   +VKVY
+Sbjct: 213 KTMVLELPFTSKHLSILILLPKDIEDDSTGLKKLEQDMTFEKYAQWTNPSMMANSKVKVY 272
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPSA-NLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ K+E  ++L  +L +LG+ D F   A + +G++ ++   ISQA+H A +E++EDG E
+Sbjct: 273 LPKFKLESSFDLKDMLKSLGINDAFNEEASDFSGMTESKDTSISQAIHKACIEVNEDGTE 332
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+               T      +     E+F AD PF+F+++HN T TI+ FGRY  P
+Sbjct: 333 APDVTME----RRLMNKEEFCADRPFIFILRHNKTRTIIMFGRYCGP 375
+
+
+>ref|XP_418982.1| PREDICTED: similar to plasminogen activator inhibitor [Gallus
+           gallus]
+          Length = 412
+
+ Score =  136 bits (342), Expect = 4e-031
+ Identities = 65/163 (39%), Positives = 105/163 (64%), Gaps = 1/163 (0%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           ++ +LELP+ + +LSM +LLP E++ L+++   + FEKL+ WT+P  MEK +++VYLP+
+Sbjct: 250 QIDVLELPYVNNELSMFILLPREITGLQKLINELTFEKLSAWTSPELMEKMKMEVYLPRF 309
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGS 119
+            +EEKY+L S L  +G+ D F    A+  G+S    L +SQ  H  ++E++E+G E A +
+Sbjct: 310 TVEEKYDLKSTLSKMGIEDAFTEGQADFRGMSENADLFLSQVFHKCYVEVNEEGTEAAAA 369
+
+Query: 120 TGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +      +    +  F ADHPFLF+I+HN T  I++ GR+ SP
+Sbjct: 370 SSASLASRTLGATVIFVADHPFLFIIRHNKTKCILFLGRFCSP 412
+
+
+>ref|NP_766640.1| serine (or cysteine) proteinase inhibitor, clade B, member 1b [Mus
+           musculus]
+ gb|AAL57487.1|AF426025_1 EIB [Mus musculus]
+ gb|AAH30354.1| Serine (or cysteine) peptidase inhibitor, clade B, member 1b [Mus
+           musculus]
+ gb|AAM95934.1| serine protease inhibitor EIB; serpin clade B; ovalbumin-related
+           serpin [Mus musculus]
+ emb|CAI25481.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 1b (Serpinb1b) [Mus musculus]
+          Length = 382
+
+ Score =  135 bits (341), Expect = 5e-031
+ Identities = 72/170 (42%), Positives = 106/170 (62%), Gaps = 8/170 (4%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K K+LE+P+  G+LSM++LLP+++ D    L++IE+ +   KL EWT    +    V V
+Sbjct: 213 KCKVLEMPYQGGELSMVILLPEDIEDESTGLKKIEEQLTLGKLHEWTKHENLRNIDVHVK 272
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ K+EE Y L S L  LG+ DLF    A+L+G+S +  L +S+ VH +F++++E G E
+Sbjct: 273 LPRFKMEESYILNSNLCCLGVQDLFSSGKADLSGMSGSRDLFVSKIVHKSFVDVNEQGTE 332
+
+Query: 116 MAGSTGVIEDI---KHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +TG I  +   K     E F  DHPFLF I+HNPT  +++FGR  SP
+Sbjct: 333 AAAATGGIIQVLCEKMPTPQEVFTVDHPFLFFIRHNPTANMIFFGRVCSP 382
+
+
+>ref|XP_001365539.1| PREDICTED: similar to SERPINB12 isoform 1 [Monodelphis domestica]
+          Length = 406
+
+ Score =  135 bits (340), Expect = 7e-031
+ Identities = 69/165 (41%), Positives = 106/165 (64%), Gaps = 5/165 (3%)
+
+Query: 3   KILELPFASGDLSMLVLLP----DEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLP 58
+           +ILE+ +  G LSM VLLP    ++ + LE +E+ +  EK+TEWT+P  M + +V V  P
+Sbjct: 242 QILEMNYTKGKLSMFVLLPPFPDEDSTGLEELERNMTHEKITEWTSPTIMCEEKVDVSFP 301
+
+Query: 59  QMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMA 117
+           Q  +E   +L  +L  +G+ D+F  + A+L+GISS+ +L +S+A+H  F+E+SEDG E A
+Sbjct: 302 QFTMESNLDLNFILQKMGIVDIFDEAKADLSGISSSPNLYLSKAIHKTFVEVSEDGTEAA 361
+
+Query: 118 GSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            +TG +   K +     F  +HPFLF IK N TNTI+++G+  SP
+Sbjct: 362 AATGAVVSTKSASPYVPFYTNHPFLFFIKDNKTNTILFYGKVCSP 406
+
+
+>ref|XP_001365600.1| PREDICTED: similar to SERPINB12 isoform 2 [Monodelphis domestica]
+          Length = 418
+
+ Score =  135 bits (340), Expect = 7e-031
+ Identities = 69/165 (41%), Positives = 106/165 (64%), Gaps = 5/165 (3%)
+
+Query: 3   KILELPFASGDLSMLVLLP----DEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLP 58
+           +ILE+ +  G LSM VLLP    ++ + LE +E+ +  EK+TEWT+P  M + +V V  P
+Sbjct: 254 QILEMNYTKGKLSMFVLLPPFPDEDSTGLEELERNMTHEKITEWTSPTIMCEEKVDVSFP 313
+
+Query: 59  QMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMA 117
+           Q  +E   +L  +L  +G+ D+F  + A+L+GISS+ +L +S+A+H  F+E+SEDG E A
+Sbjct: 314 QFTMESNLDLNFILQKMGIVDIFDEAKADLSGISSSPNLYLSKAIHKTFVEVSEDGTEAA 373
+
+Query: 118 GSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            +TG +   K +     F  +HPFLF IK N TNTI+++G+  SP
+Sbjct: 374 AATGAVVSTKSASPYVPFYTNHPFLFFIKDNKTNTILFYGKVCSP 418
+
+
+>ref|XP_001365664.1| PREDICTED: similar to SERPINB12 isoform 3 [Monodelphis domestica]
+          Length = 426
+
+ Score =  135 bits (340), Expect = 7e-031
+ Identities = 69/165 (41%), Positives = 106/165 (64%), Gaps = 5/165 (3%)
+
+Query: 3   KILELPFASGDLSMLVLLP----DEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLP 58
+           +ILE+ +  G LSM VLLP    ++ + LE +E+ +  EK+TEWT+P  M + +V V  P
+Sbjct: 262 QILEMNYTKGKLSMFVLLPPFPDEDSTGLEELERNMTHEKITEWTSPTIMCEEKVDVSFP 321
+
+Query: 59  QMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMA 117
+           Q  +E   +L  +L  +G+ D+F  + A+L+GISS+ +L +S+A+H  F+E+SEDG E A
+Sbjct: 322 QFTMESNLDLNFILQKMGIVDIFDEAKADLSGISSSPNLYLSKAIHKTFVEVSEDGTEAA 381
+
+Query: 118 GSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            +TG +   K +     F  +HPFLF IK N TNTI+++G+  SP
+Sbjct: 382 AATGAVVSTKSASPYVPFYTNHPFLFFIKDNKTNTILFYGKVCSP 426
+
+
+>gb|AAC95432.1| squamous cell carcinoma antigen 2 [Mus musculus]
+          Length = 388
+
+ Score =  135 bits (340), Expect = 7e-031
+ Identities = 66/161 (40%), Positives = 106/161 (65%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KI+E+P+   +LSM+VLLP E++ L+++E+ +  +KL EWT    M    + + LP+ K+
+Sbjct: 228 KIVEIPYKGKELSMIVLLPVEINGLKQLEEQLTADKLLEWTRAENMHMTELYLSLPRFKV 287
+
+Query: 63  EEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           +EKY+L   L  +GM D F P  A+ +G+SS + L +S+ +H +F+E++E+G E A +TG
+Sbjct: 288 DEKYDLPIPLEHMGMVDAFDPQKADFSGMSSTQGLVVSKVLHKSFVEVNEEGTEAAAATG 347
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V   +  +  +E F  DHPFLF I H  T++I++FGR  SP
+Sbjct: 348 VEVSLTSAQIAEDFCCDHPFLFFIIHRKTSSILFFGRISSP 388
+
+
+>gb|AAN62872.1| squamous cell carcinoma antigen 2 related protein 1 [Mus musculus]
+ gb|AAN62873.1| squamous cell carcinoma antigen 2 related protein 1 [Mus musculus]
+          Length = 387
+
+ Score =  134 bits (338), Expect = 1e-030
+ Identities = 67/161 (41%), Positives = 103/161 (63%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +I+E+P+   DLSM VLLP E+  L+++E+ +  +KL EW     M    + + LP+ K+
+Sbjct: 227 QIVEIPYKGKDLSMFVLLPMEIDGLKQLEEQLTTDKLLEWIKAENMHLTELYLSLPRFKV 286
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EEKY+L   L  +GM D F P  A+ +G+SS   L +S+ +H +F+E++E+G E A +TG
+Sbjct: 287 EEKYDLQVPLEHMGMVDAFDPQKADFSGMSSIPGLVVSKVLHKSFVEVNEEGTEAAAATG 346
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V   ++ +  +E F  DHPFLF I H  TN+I++FGR  SP
+Sbjct: 347 VEVSVRSAQIAEDFCCDHPFLFFIIHRKTNSILFFGRISSP 387
+
+
+>ref|NP_941373.1| serine (or cysteine) proteinase inhibitor, clade b, member 3b [Mus
+           musculus]
+ dbj|BAB22650.1| unnamed protein product [Mus musculus]
+          Length = 387
+
+ Score =  134 bits (338), Expect = 1e-030
+ Identities = 67/161 (41%), Positives = 103/161 (63%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +I+E+P+   DLSM VLLP E+  L+++E+ +  +KL EW     M    + + LP+ K+
+Sbjct: 227 QIVEIPYKGKDLSMFVLLPMEIDGLKQLEEQLTTDKLLEWIKAENMHLTELYLSLPRFKV 286
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EEKY+L   L  +GM D F P  A+ +G+SS   L +S+ +H +F+E++E+G E A +TG
+Sbjct: 287 EEKYDLQVPLEHMGMVDAFDPQKADFSGMSSIPGLVVSKVLHKSFVEVNEEGTEAAAATG 346
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V   ++ +  +E F  DHPFLF I H  TN+I++FGR  SP
+Sbjct: 347 VEVSVRSAQIAEDFCCDHPFLFFIIHRMTNSILFFGRICSP 387
+
+
+>gb|AAR89288.1| serpinb3b [Mus musculus]
+ gb|AAH99584.1| Serine (or cysteine) peptidase inhibitor, clade B (ovalbumin),
+           member 3B [Mus musculus]
+          Length = 387
+
+ Score =  134 bits (337), Expect = 2e-030
+ Identities = 67/161 (41%), Positives = 103/161 (63%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +I+E+P+   DLSM VLLP E+  L+++E+ +  +KL EW     M    + + LP+ K+
+Sbjct: 227 QIVEIPYKGKDLSMFVLLPMEIDGLKQLEEQLTTDKLLEWIKAENMHLTELYLSLPRFKV 286
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EEKY+L   L  +GM D F P  A+ +G+SS   L +S+ +H +F+E++E+G E A +TG
+Sbjct: 287 EEKYDLQVPLEHMGMVDAFDPQKADFSGMSSIPGLVVSKVLHKSFVEVNEEGTEAAAATG 346
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V   ++ +  +E F  DHPFLF I H  TN+I++FGR  SP
+Sbjct: 347 VEVSVRSAQIAEDFCCDHPFLFFIIHRMTNSILFFGRISSP 387
+
+
+>ref|XP_541071.2| PREDICTED: similar to Serpin B10 (Bomapin) (Protease inhibitor 10)
+           [Canis familiaris]
+          Length = 397
+
+ Score =  134 bits (337), Expect = 2e-030
+ Identities = 66/159 (41%), Positives = 108/159 (67%), Gaps = 1/159 (0%)
+
+Query: 5   LELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEE 64
+           L+L + S DLS+LVLLP++V  L+++E+ I +EKL+EWT+ + ME   V+++LP+ ++EE
+Sbjct: 239 LQLYYDSHDLSLLVLLPEDVDGLDQLERAITYEKLSEWTSADMMELYEVELHLPKFRLEE 298
+
+Query: 65  KYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVI 123
+            Y+L S L ++GM+D F    A+ +G+S   +L +S   H +F+E++E G E A  +G
+Sbjct: 299 TYDLKSSLRSMGMSDAFNQGKADFSGMSMEGNLFLSNVFHKSFIEINEQGTEAAAGSGSE 358
+
+Query: 124 EDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+             I+      +F A+HPFLF I+HN T +I+++GR+ SP
+Sbjct: 359 VSIRSRLPPIEFNANHPFLFFIRHNKTASILFYGRFCSP 397
+
+
+>ref|XP_533382.2| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B (ovalbumin), member 5 [Canis familiaris]
+          Length = 823
+
+ Score =  134 bits (337), Expect = 2e-030
+ Identities = 69/167 (41%), Positives = 101/167 (60%), Gaps = 5/167 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLP----DEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILE+ +  G LSM VLLP    D V  LE +EK I  EK+  W++   M +  V+V
+Sbjct: 657 KAQILEMRYIKGALSMFVLLPPYSADNVKGLEELEKNITHEKIVAWSSSENMSEETVEVS 716
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+            PQ  +E+ Y+L S+L  +G+TD+F    A+LTGIS + +L +S+ VH  F+E+ EDG +
+Sbjct: 717 FPQFTLEDSYDLNSILQDMGITDVFEEGKADLTGISPSPNLYLSKVVHKTFVEVDEDGTQ 776
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+              ++G +   +       F  DHPFLF I+HN T TI+++GR  SP
+Sbjct: 777 AVAASGAVGMERSLSSGVTFTVDHPFLFFIRHNKTKTILFYGRVCSP 823
+
+
+
+ Score =  123 bits (308), Expect = 4e-027
+ Identities = 63/167 (37%), Positives = 110/167 (65%), Gaps = 15/167 (8%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVYLP 58
+           KI+ELPF +  LSML+LLP +V D    LE++E+ +N E L +WTNP+TM   +VK+ +P
+Sbjct: 227 KIIELPFQNKHLSMLILLPKDVEDESTGLEKVEQQLNSETLLQWTNPSTMANAKVKLSIP 286
+
+Query: 59  QMKIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDG---I 114
+           + K+E+  +  + L  LG+ ++F   +++ +G+S  + + +S  +H   +E++EDG   I
+Sbjct: 287 KFKVEKIIDPKASLENLGLKNIFNENTSDFSGMSETKGVALSNVIHRVCLEITEDGGDSI 346
+
+Query: 115 EMAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWS 161
+           E+ GS      ++H    ++F ADHPF+++I+HN T  I++FG+++S
+Sbjct: 347 EVPGS----RILQH---KDEFNADHPFIYIIRHNKTRNIIFFGKFYS 386
+
+
+>ref|NP_001011419.1| hypothetical protein LOC496899 [Xenopus tropicalis]
+ gb|AAH88021.1| Hypothetical LOC496899 [Xenopus tropicalis]
+          Length = 377
+
+ Score =  134 bits (337), Expect = 2e-030
+ Identities = 70/165 (42%), Positives = 111/165 (67%), Gaps = 8/165 (4%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVYLP 58
+           ++LELP+   +LSM+++LPD ++D    L+++EK ++ EK+ EWT    M    V V+LP
+Sbjct: 216 RVLELPYVDYELSMVIVLPDNINDDTTGLQQLEKELSLEKINEWTE--NMMPIDVHVHLP 273
+
+Query: 59  QMKIEEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIEMA 117
+           + K+E+ Y L S L  +GM DLF   SA+L+G+S +  L +S+ +H +F+E++E+G E A
+Sbjct: 274 KFKLEDSYKLKSQLAGMGMADLFEAGSADLSGMSGSNDLYLSEVIHKSFVEVNEEGTEAA 333
+
+Query: 118 GSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            ++  I  +    E E+F A+HPFLF I+HN T +I++FGRY SP
+Sbjct: 334 AASAGIAMMCLMRE-EEFNANHPFLFFIRHNATKSILFFGRYSSP 377
+
+
+>ref|NP_001012214.1| serine (or cysteine) proteinase inhibitor, clade B, member 6b
+           [Rattus norvegicus]
+ gb|AAH79108.1| Serine (or cysteine) proteinase inhibitor, clade B, member 6b
+           [Rattus norvegicus]
+          Length = 377
+
+ Score =  134 bits (337), Expect = 2e-030
+ Identities = 68/160 (42%), Positives = 107/160 (66%), Gaps = 3/160 (1%)
+
+Query: 4   ILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIE 63
+           IL LP+   +L+M+++LPDE  +L  +EK I ++K  EWT+ + ME+R V+V+LP+ K+E
+Sbjct: 220 ILLLPYVGNELNMIIMLPDEHIELRMVEKEITYKKFIEWTSLDKMEEREVEVFLPKFKLE 279
+
+Query: 64  EKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           E +++  VL  LGMTD F    A+ +GI+S E L +S+ +H +F+E++E+G E A +T
+Sbjct: 280 ENHDMKDVLHRLGMTDAFEQGMADFSGIASKEGLFLSKVIHKSFVEVNEEGTEAAAATAA 339
+
+Query: 123 IEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+             ++        F A+HPFLF I+H+ TN IV+ GR+ SP
+Sbjct: 340 --NVTFRCMVPYFCANHPFLFFIQHSRTNGIVFCGRFSSP 377
+
+
+>emb|CAF98097.1| unnamed protein product [Tetraodon nigroviridis]
+          Length = 380
+
+ Score =  134 bits (337), Expect = 2e-030
+ Identities = 74/167 (44%), Positives = 106/167 (63%), Gaps = 7/167 (4%)
+
+Query: 2   MKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTME-KRRVKVY 56
+           ++ILELP+A  +LSM +LLP+E +D    L ++E  +  EKL EWTN   M+    V+V+
+Sbjct: 214 LQILELPYAQEELSMFILLPEETTDGSNPLLKLENELTREKLDEWTNRENMDVSSEVRVH 273
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ K+EE Y +   L  LGMTD+F    A+L+G++S   L +S   H AF+E++E+G E
+Sbjct: 274 LPKFKLEENYEMKEALAKLGMTDVFCAGKADLSGMNSDGGLFLSTVAHKAFVEVNEEGTE 333
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +T  +       E E F ADHPFLF I+HN T +I++ GRY SP
+Sbjct: 334 AAAATVAMVTFCMLRE-EHFTADHPFLFFIRHNKTKSILFLGRYSSP 379
+
+
+>ref|XP_001376191.1| PREDICTED: similar to Leukocyte elastase inhibitor (LEI) (Serpin
+           B1) (Monocyte/neutrophil elastase inhibitor) (M/NEI)
+           (EI) [Monodelphis domestica]
+          Length = 416
+
+ Score =  134 bits (336), Expect = 2e-030
+ Identities = 70/163 (42%), Positives = 101/163 (61%), Gaps = 5/163 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K ++LELP+   +LSM +LLPD++ D    LE+IEK ++ EK TEWTNP  M    V V
+Sbjct: 248 KCRVLELPYKGKELSMTILLPDDIEDDSTGLEKIEKHLSMEKFTEWTNPKNMSTIDVHVR 307
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ K+E  YNL S L  +G+ DLF  S A+L+G+S  + L IS+ VH A +E++E+G E
+Sbjct: 308 LPRFKMENSYNLDSDLAQMGLDDLFNRSKADLSGMSGTKDLFISKIVHKAVVEVNEEGTE 367
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGR 158
+            A +T  I         E+F  DHPF+F+I +     I++ G+
+Sbjct: 368 AAAATAGIATFAMLMPEEEFTVDHPFIFIINNKSNGNIIFMGK 410
+
+
+>dbj|BAD92800.1| Hypothetical protein DKFZp686I04222 variant [Homo sapiens]
+          Length = 393
+
+ Score =  134 bits (336), Expect = 2e-030
+ Identities = 66/156 (42%), Positives = 106/156 (67%), Gaps = 2/156 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +IL LP+   +L+M+++LPDE +DL  +EK + +EK  EWT  + M++  V+V LP+ K+
+Sbjct: 239 QILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKL 298
+
+Query: 63  EEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y++ SVL  LGMTD F +  A+ +G+S  + L +S+ VH +F+E++E+G E A +T
+Sbjct: 299 EESYDMESVLRNLGMTDAFELGKADFSGMSQTD-LSLSKVVHKSFVEVNEEGTEAAAATA 357
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFG 157
+            I  ++ +    +F ADHPFLF I+H+ TN I++ G
+Sbjct: 358 AIMMMRCARFVPRFCADHPFLFFIQHSKTNGILFCG 393
+
+
+>ref|XP_582291.2| PREDICTED: similar to plasminogen activator inhibitor [Bos taurus]
+          Length = 416
+
+ Score =  134 bits (336), Expect = 2e-030
+ Identities = 71/167 (42%), Positives = 107/167 (64%), Gaps = 6/167 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K++ILELP+A GD+SM +LLPD +++    LE +E  I ++KL +W + +TM +  V VY
+Sbjct: 251 KVQILELPYA-GDVSMFLLLPDGIAESSTGLEMLESEITYDKLNKWLSKDTMAEDDVVVY 309
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           +P+ K+EE Y L ++L ++GM D F    AN +G+S    L +S+  H A +E++E+G E
+Sbjct: 310 IPEFKLEEHYELKTILTSMGMGDAFSQGRANFSGMSGKNDLFLSEVFHQASVEVNEEGTE 369
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A  TG I   +      QF ADHPFLF I H  T +I+++GR+ SP
+Sbjct: 370 AAAGTGAIMTGRTGHGGPQFVADHPFLFFIMHKITKSILFWGRFASP 416
+
+
+>ref|NP_899020.1| serine (or cysteine) proteinase inhibitor, clade B, member 9f [Mus
+           musculus]
+ gb|AAH52216.1| Serine (or cysteine) peptidase inhibitor, clade B, member 9f [Mus
+           musculus]
+          Length = 377
+
+ Score =  133 bits (335), Expect = 3e-030
+ Identities = 67/162 (41%), Positives = 108/162 (66%), Gaps = 2/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           ++L +P+   DL+ +VLLPDE  D+ ++E  + FEKLT WT P  M +    VYLP+ ++
+Sbjct: 216 QVLVMPYEGIDLNFVVLLPDEGVDISKVENNLTFEKLTAWTKPEFMNRTEFHVYLPKFQL 275
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           +E Y++ S+L  LG+ ++F  S A+L+G+S+ E+L +S+ VH   +E++E+G E A ++
+Sbjct: 276 QEDYDMNSLLQHLGILNVFDGSKADLSGMSTKENLCLSEFVHKCVVEVNEEGTEAAAASA 335
+
+Query: 122 V-IEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V    +   P+ E F ADHPFLF I H+ TN+I++ GR+ SP
+Sbjct: 336 VEFIFLCLGPDPETFCADHPFLFFIMHSTTNSILFCGRFSSP 377
+
+
+>emb|CAF98095.1| unnamed protein product [Tetraodon nigroviridis]
+          Length = 303
+
+ Score =  132 bits (333), Expect = 5e-030
+ Identities = 74/167 (44%), Positives = 105/167 (62%), Gaps = 7/167 (4%)
+
+Query: 2   MKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTME-KRRVKVY 56
+           ++ILELP+A  +LSM +LLP+E +D    L ++E  +  EKL EWTN   M+    V V+
+Sbjct: 137 LQILELPYAQEELSMFILLPEETTDGSNPLLKLENELTREKLDEWTNRENMDVSSEVLVH 196
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ K+EE Y +   L  LGMTD+F    A+L+G++S   L +S   H AF+E++E+G E
+Sbjct: 197 LPKFKLEENYEMKEALAKLGMTDVFCAGKADLSGMNSDGGLFLSTVAHKAFVEVNEEGTE 256
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +T  +       E E F ADHPFLF I+HN T +I++ GRY SP
+Sbjct: 257 AAAATVAMVTFCMLRE-EHFTADHPFLFFIRHNKTKSILFLGRYSSP 302
+
+
+>ref|XP_001160007.1| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 9 isoform 2 [Pan troglodytes]
+          Length = 380
+
+ Score =  132 bits (332), Expect = 6e-030
+ Identities = 71/168 (42%), Positives = 111/168 (66%), Gaps = 6/168 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLER----IEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           + ++LELP+A  +LS+LVLLPD+  +L      +EK++ FEKLT WT P+ M+   V+V
+Sbjct: 213 RAQLLELPYAGKELSLLVLLPDDGVELSTGYCLVEKSLTFEKLTAWTKPDCMKSTEVEVL 272
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ K++E Y++ SVL  LG+ D F    A+L+ +S+   L +S+ VH +F+E++E+G E
+Sbjct: 273 LPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTE 332
+
+Query: 116 MAGSTGVIEDIKHSPES-EQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A ++      +   ES  +F ADHPFLF I+HN  N+I++ GR+ SP
+Sbjct: 333 AAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP 380
+
+
+>emb|CAI25478.1| serine protease inhibitor 12 [Mus musculus]
+          Length = 374
+
+ Score =  132 bits (332), Expect = 6e-030
+ Identities = 68/160 (42%), Positives = 105/160 (65%), Gaps = 3/160 (1%)
+
+Query: 4   ILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIE 63
+           IL LP+   +L+M+++LPDE  +L  +EK I ++K  EWT  + ME+  V+V+LP+ K+E
+Sbjct: 217 ILLLPYVGNELNMIIMLPDEHIELSMVEKEITYKKFIEWTRLDKMEEEEVEVFLPKFKLE 276
+
+Query: 64  EKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           E Y++  VL  LGMTD F    A+ +GI+S E L +S+ +H +F+E++E+G E A +T
+Sbjct: 277 ENYDMKDVLCRLGMTDAFEEGMADFSGIASKEGLFLSKVIHKSFVEVNEEGTEAAAATAA 336
+
+Query: 123 IEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+             +I        F A+HPFLF I+H+ T+ IV+ GR+ SP
+Sbjct: 337 --NIGFRCMVPYFCANHPFLFFIQHSRTSGIVFCGRFSSP 374
+
+
+>ref|NP_001002653.1| serpin peptidase inhibitor, clade B (ovalbumin), member 1 [Danio
+           rerio]
+ gb|AAH76524.1| Serpin peptidase inhibitor, clade B (ovalbumin), member 1 [Danio
+           rerio]
+ emb|CAI20749.1| novel protein similar to vertebrate serine (or cysteine) proteinase
+           inhibitor, clade B (ovalbumin) family member [Danio
+           rerio]
+ gb|AAI33836.1| Serpin peptidase inhibitor, clade B (ovalbumin), member 1 [Danio
+           rerio]
+          Length = 380
+
+ Score =  132 bits (332), Expect = 6e-030
+ Identities = 70/168 (41%), Positives = 109/168 (64%), Gaps = 7/168 (4%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRR-VKV 55
+           ++++LELP+   +LSML+LLP+E  D    L ++E  +  +KL EWTN N M+ +  + V
+Sbjct: 213 RVQVLELPYVKEELSMLILLPEETQDGSDPLLKLESELTIDKLHEWTNRNNMDTQTDIIV 272
+
+Query: 56  YLPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGI 114
+           +LP+ K+E + +L  +LM +GM+ +F    A+LTG++    L +S   H AF++++E+G
+Sbjct: 273 HLPRFKLEIESSLVEILMGMGMSSVFQEGKADLTGMTGHGGLFLSAVAHKAFVDVNEEGT 332
+
+Query: 115 EMAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           E A +T  I       E E F ADHPFLF I+HNPTN+I++FGR+  P
+Sbjct: 333 EAAAATAAIVAFCMLRE-EHFMADHPFLFYIRHNPTNSILFFGRFRGP 379
+
+
+>ref|NP_035584.1| serine (or cysteine) proteinase inhibitor, clade B, member 6b [Mus
+           musculus]
+ gb|AAB57819.2| NK13 [Mus musculus]
+ dbj|BAC39278.1| unnamed protein product [Mus musculus]
+ gb|AAH61050.1| Serine (or cysteine) peptidase inhibitor, clade B, member 6b [Mus
+           musculus]
+ dbj|BAE32338.1| unnamed protein product [Mus musculus]
+          Length = 377
+
+ Score =  132 bits (332), Expect = 6e-030
+ Identities = 68/160 (42%), Positives = 105/160 (65%), Gaps = 3/160 (1%)
+
+Query: 4   ILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIE 63
+           IL LP+   +L+M+++LPDE  +L  +EK I ++K  EWT  + ME+  V+V+LP+ K+E
+Sbjct: 220 ILLLPYVGNELNMIIMLPDEHIELSMVEKEITYKKFIEWTRLDKMEEEEVEVFLPKFKLE 279
+
+Query: 64  EKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           E Y++  VL  LGMTD F    A+ +GI+S E L +S+ +H +F+E++E+G E A +T
+Sbjct: 280 ENYDMKDVLCRLGMTDAFEEGMADFSGIASKEGLFLSKVIHKSFVEVNEEGTEAAAATAA 339
+
+Query: 123 IEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+             +I        F A+HPFLF I+H+ T+ IV+ GR+ SP
+Sbjct: 340 --NIGFRCMVPYFCANHPFLFFIQHSRTSGIVFCGRFSSP 377
+
+
+>gb|AAL65909.1|AF425083_1 NK21B [Mus musculus]
+ gb|AAH64758.1| Serine (or cysteine) peptidase inhibitor, clade B, member 9g [Mus
+           musculus]
+ gb|AAH64759.1| Serine (or cysteine) peptidase inhibitor, clade B, member 9g [Mus
+           musculus]
+ emb|CAI25636.1| serine (or cysteine) proteinase inhibitor (Serpin, Spi) family
+           member NK21L1 (1600002F03Rik) [Mus musculus]
+          Length = 377
+
+ Score =  132 bits (332), Expect = 6e-030
+ Identities = 66/162 (40%), Positives = 106/162 (65%), Gaps = 2/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           ++L +P+   DL+ +VLLPDE  D+ ++E  + FEKLT WT P  M +    VYLP+ ++
+Sbjct: 216 QVLVMPYEGIDLNFVVLLPDEGVDISKVENNLTFEKLTAWTKPEFMNRTEFHVYLPKFQL 275
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           +E Y++ S+L  LG+ ++F  S A+L+G+S+ E+L +S+  H   +E++E+G E A ++
+Sbjct: 276 QEDYDMNSLLQHLGILNVFDGSKADLSGMSTKENLCLSEFAHKCVVEVNEEGTEAAAASA 335
+
+Query: 122 V-IEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V    +   P+ E F ADHPFLF I H  TN+I++ GR+ SP
+Sbjct: 336 VKFIFLCSGPDPETFCADHPFLFFIMHRTTNSILFCGRFSSP 377
+
+
+>ref|XP_619089.1| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B, member 9f [Mus musculus]
+ ref|XP_977724.1| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B, member 9f [Mus musculus]
+          Length = 377
+
+ Score =  132 bits (332), Expect = 6e-030
+ Identities = 66/162 (40%), Positives = 107/162 (66%), Gaps = 2/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           ++L +P+   DL+ +VLLPDE  D+ ++E  + FEKLT WT P  M +    VY P+ ++
+Sbjct: 216 QVLVMPYEGIDLNFVVLLPDEGVDISKVENNLTFEKLTAWTKPEFMNRTEFHVYYPKFQL 275
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           +E Y++ S+L  LG+ ++F  S A+L+G+S+ E+L +S+ VH   +E++E+G E A ++
+Sbjct: 276 QEDYDMNSLLQHLGILNVFDGSKADLSGMSTKENLCLSEFVHKCVVEVNEEGTEAAAASA 335
+
+Query: 122 V-IEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V    +   P+ E F ADHPFLF I H+ TN+I++ GR+ SP
+Sbjct: 336 VEFIFLCSGPDPETFCADHPFLFFIMHSTTNSILFCGRFSSP 377
+
+
+>ref|NP_001008887.1| serine protease inhibitor B3 [Rattus norvegicus]
+ tpe|CAE51401.1| TPA: serine protease inhibitor B3 [Rattus norvegicus]
+          Length = 326
+
+ Score =  132 bits (332), Expect = 6e-030
+ Identities = 62/161 (38%), Positives = 106/161 (65%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K++E+P+   +LSM +LLP E+  L+++E+ ++ + L  WT+P  M   ++ + LP+ K+
+Sbjct: 166 KMVEIPYKGKELSMFILLPMEIDGLKKLEEKLSADTLLAWTSPKNMRMTQLNLSLPRFKV 225
+
+Query: 63  EEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           +EKY+L   L  +GM D F P  A+ +G+SS + L +S+ +H +F+E++E+G E A +TG
+Sbjct: 226 QEKYDLPGPLEHMGMVDAFNPQKADFSGMSSTKGLVVSKVLHKSFLEVNEEGAEAAAATG 285
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V   I  +P + +F  + PF+  IK N TN+I++FGR  SP
+Sbjct: 286 VETRILSAPRTTEFTCNRPFIVFIKPNNTNSILFFGRVSSP 326
+
+
+>ref|XP_001147068.1| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 12 isoform 1 [Pan troglodytes]
+          Length = 405
+
+ Score =  132 bits (331), Expect = 8e-030
+ Identities = 65/167 (38%), Positives = 105/167 (62%), Gaps = 5/167 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLP----DEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILE+ +  G LSM VLLP    D +  LE +E+ I +EK+  W++   M +  V +
+Sbjct: 239 KAQILEMRYTKGKLSMFVLLPSHSKDNLKGLEELERKITYEKMVAWSSSENMSEESVVLS 298
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+            P+  +E+ Y+L S+L  +G+TD+F  + A+LTGIS + +L +S+ +H  F+E+ E+G +
+Sbjct: 299 FPRFTLEDSYDLNSILQDMGITDIFDETRADLTGISPSPNLYLSKIIHKTFVEVDENGTQ 358
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +TG +   +      +F A+HPFLF I+HN T TI+++GR  SP
+Sbjct: 359 AAAATGAVVSERSLRSWVEFNANHPFLFFIRHNKTQTILFYGRVCSP 405
+
+
+>ref|XP_523956.2| PREDICTED: serine (or cysteine) proteinase inhibitor, clade B
+           (ovalbumin), member 12 isoform 2 [Pan troglodytes]
+          Length = 425
+
+ Score =  132 bits (331), Expect = 8e-030
+ Identities = 65/167 (38%), Positives = 105/167 (62%), Gaps = 5/167 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLP----DEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILE+ +  G LSM VLLP    D +  LE +E+ I +EK+  W++   M +  V +
+Sbjct: 259 KAQILEMRYTKGKLSMFVLLPSHSKDNLKGLEELERKITYEKMVAWSSSENMSEESVVLS 318
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+            P+  +E+ Y+L S+L  +G+TD+F  + A+LTGIS + +L +S+ +H  F+E+ E+G +
+Sbjct: 319 FPRFTLEDSYDLNSILQDMGITDIFDETRADLTGISPSPNLYLSKIIHKTFVEVDENGTQ 378
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +TG +   +      +F A+HPFLF I+HN T TI+++GR  SP
+Sbjct: 379 AAAATGAVVSERSLRSWVEFNANHPFLFFIRHNKTQTILFYGRVCSP 425
+
+
+>gb|AAI03885.1| SERPINB12 protein [Homo sapiens]
+          Length = 183
+
+ Score =  132 bits (331), Expect = 8e-030
+ Identities = 65/167 (38%), Positives = 105/167 (62%), Gaps = 5/167 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLP----DEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILE+ +  G LSM VLLP    D +  LE +E+ I +EK+  W++   M +  V +
+Sbjct: 17  KAQILEMRYTKGKLSMFVLLPSHSKDNLKGLEELERKITYEKMVAWSSSENMSEESVVLS 76
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+            P+  +E+ Y+L S+L  +G+TD+F  + A+LTGIS + +L +S+ +H  F+E+ E+G +
+Sbjct: 77  FPRFTLEDSYDLNSILQDMGITDIFDETRADLTGISPSPNLYLSKIIHKTFVEVDENGTQ 136
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +TG +   +      +F A+HPFLF I+HN T TI+++GR  SP
+Sbjct: 137 AAAATGAVVSERSLRSWVEFNANHPFLFFIRHNKTQTILFYGRVCSP 183
+
+
+>gb|AAI03886.1| SERPINB12 protein [Homo sapiens]
+          Length = 425
+
+ Score =  132 bits (331), Expect = 8e-030
+ Identities = 65/167 (38%), Positives = 105/167 (62%), Gaps = 5/167 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLP----DEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILE+ +  G LSM VLLP    D +  LE +E+ I +EK+  W++   M +  V +
+Sbjct: 259 KAQILEMRYTKGKLSMFVLLPSHSKDNLKGLEELERKITYEKMVAWSSSENMSEESVVLS 318
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+            P+  +E+ Y+L S+L  +G+TD+F  + A+LTGIS + +L +S+ +H  F+E+ E+G +
+Sbjct: 319 FPRFTLEDSYDLNSILQDMGITDIFDETRADLTGISPSPNLYLSKIIHKTFVEVDENGTQ 378
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +TG +   +      +F A+HPFLF I+HN T TI+++GR  SP
+Sbjct: 379 AAAATGAVVSERSLRSWVEFNANHPFLFFIRHNKTQTILFYGRVCSP 425
+
+
+>dbj|BAE42644.1| unnamed protein product [Mus musculus]
+          Length = 258
+
+ Score =  132 bits (331), Expect = 8e-030
+ Identities = 68/160 (42%), Positives = 104/160 (65%), Gaps = 3/160 (1%)
+
+Query: 4   ILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIE 63
+           IL LP+   +L+M+++LPDE  +L  +EK I ++K  EWT    ME+  V+V+LP+ K+E
+Sbjct: 101 ILLLPYVGNELNMIIMLPDEHIELSMVEKEITYKKFIEWTRLEKMEEEEVEVFLPKFKLE 160
+
+Query: 64  EKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           E Y++  VL  LGMTD F    A+ +GI+S E L +S+ +H +F+E++E+G E A +T
+Sbjct: 161 ENYDMKDVLCRLGMTDAFEEGMADFSGIASKEGLFLSKVIHKSFVEVNEEGTEAAAATAA 220
+
+Query: 123 IEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+             +I        F A+HPFLF I+H+ T+ IV+ GR+ SP
+Sbjct: 221 --NIGFRCMVPYFCANHPFLFFIQHSRTSGIVFCGRFSSP 258
+
+
+>ref|NP_536722.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 12 [Homo sapiens]
+ sp|Q96P63|SPB12_HUMAN Serpin B12
+ gb|AAL05571.1|AF411191_1 SERPINB12 [Homo sapiens]
+ gb|EAW63149.1| serpin peptidase inhibitor, clade B (ovalbumin), member 12 [Homo
+           sapiens]
+          Length = 405
+
+ Score =  132 bits (331), Expect = 8e-030
+ Identities = 65/167 (38%), Positives = 105/167 (62%), Gaps = 5/167 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLP----DEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILE+ +  G LSM VLLP    D +  LE +E+ I +EK+  W++   M +  V +
+Sbjct: 239 KAQILEMRYTKGKLSMFVLLPSHSKDNLKGLEELERKITYEKMVAWSSSENMSEESVVLS 298
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+            P+  +E+ Y+L S+L  +G+TD+F  + A+LTGIS + +L +S+ +H  F+E+ E+G +
+Sbjct: 299 FPRFTLEDSYDLNSILQDMGITDIFDETRADLTGISPSPNLYLSKIIHKTFVEVDENGTQ 358
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +TG +   +      +F A+HPFLF I+HN T TI+++GR  SP
+Sbjct: 359 AAAATGAVVSERSLRSWVEFNANHPFLFFIRHNKTQTILFYGRVCSP 405
+
+
+>ref|XP_001090435.1| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B (ovalbumin), member 12 isoform 1 [Macaca
+           mulatta]
+          Length = 405
+
+ Score =  131 bits (330), Expect = 1e-029
+ Identities = 65/167 (38%), Positives = 104/167 (62%), Gaps = 5/167 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLP----DEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILE+ +  G LSM VLLP    D +  LE +E  I +E +  W++   M +  V +
+Sbjct: 239 KAQILEMRYTKGKLSMFVLLPSHSKDNLKALEELEGKITYENIVAWSSSENMSEESVVLS 298
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+            P+  +E+ Y+L S+L  +G+TD+F  + A+LTGIS + +L +S+ +H  F+E+ E+G +
+Sbjct: 299 FPRFTLEDSYDLNSILQDMGITDIFDETRADLTGISPSPNLYLSKIIHKTFVEVDENGTQ 358
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +TG +   +  P   +F A+HPFLF I+HN T TI+++GR  SP
+Sbjct: 359 AAAATGAVVSERSLPSWVEFNANHPFLFFIRHNKTQTILFYGRVCSP 405
+
+
+>ref|XP_001090546.1| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B (ovalbumin), member 12 isoform 2 [Macaca
+           mulatta]
+          Length = 425
+
+ Score =  131 bits (330), Expect = 1e-029
+ Identities = 65/167 (38%), Positives = 104/167 (62%), Gaps = 5/167 (2%)
+
+Query: 1   KMKILELPFASGDLSMLVLLP----DEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILE+ +  G LSM VLLP    D +  LE +E  I +E +  W++   M +  V +
+Sbjct: 259 KAQILEMRYTKGKLSMFVLLPSHSKDNLKALEELEGKITYENIVAWSSSENMSEESVVLS 318
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+            P+  +E+ Y+L S+L  +G+TD+F  + A+LTGIS + +L +S+ +H  F+E+ E+G +
+Sbjct: 319 FPRFTLEDSYDLNSILQDMGITDIFDETRADLTGISPSPNLYLSKIIHKTFVEVDENGTQ 378
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A +TG +   +  P   +F A+HPFLF I+HN T TI+++GR  SP
+Sbjct: 379 AAAATGAVVSERSLPSWVEFNANHPFLFFIRHNKTQTILFYGRVCSP 425
+
+
+>gb|AAH54232.1| MGC64421 protein [Xenopus laevis]
+          Length = 379
+
+ Score =  131 bits (330), Expect = 1e-029
+ Identities = 61/165 (36%), Positives = 108/165 (65%), Gaps = 5/165 (3%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVYLP 58
+           K++E+P+   +LSM++LLPD+++D    LE++EK + +EK  +WTNP  M+   +++ LP
+Sbjct: 215 KVIEIPYVDNELSMIILLPDDINDGTTGLEKLEKELTYEKFLQWTNPEMMDITEMELSLP 274
+
+Query: 59  QMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMA 117
+           + K+E+ Y+L S+L  +GM+D F    A+ +G+S    L +S+ VH +F++++E+G E A
+Sbjct: 275 KFKLEDDYDLESLLSKMGMSDAFDQGRADFSGMSGCNDLFLSKVVHKSFVDVNEEGTEAA 334
+
+Query: 118 GSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            +T  I  ++ +    +   DHPFLF I H   ++I++ GR+ SP
+Sbjct: 335 AATAAIMMLRCAMRIPRIVCDHPFLFYIMHRQNHSILFCGRFASP 379
+
+
+>ref|NP_001069327.1| hypothetical protein LOC524513 [Bos taurus]
+ gb|AAI23623.1| Similar to Cytoplasmic antiproteinase 3 (CAP3) (CAP-3) (Protease
+           inhibitor 9) (Serpin B9) [Bos taurus]
+          Length = 374
+
+ Score =  131 bits (330), Expect = 1e-029
+ Identities = 66/161 (40%), Positives = 106/161 (65%), Gaps = 2/161 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           K+LELP+A  +LSMLVLLPD+   L  +EK + +EK   WT+P++M+K +V V+LP+ K+
+Sbjct: 215 KVLELPYAGEELSMLVLLPDDHVPLNSVEKHLTWEKFLAWTHPDSMKKTQVSVFLPKFKL 274
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+            + YN+ SVL  L + + F P  A+ +G+S  + L +S   H + +E++E+G E A ++
+Sbjct: 275 GKTYNMRSVLSGLRVAEAFQPGRADFSGMSHGKGLCLSTLAHRSVVEVNEEGTEAAAASA 334
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            IE +    +  +F ADHPFLF I+HN + + ++ GR+ SP
+Sbjct: 335 AIE-VDCGLDQPRFCADHPFLFFIRHNGSRSTLFCGRFSSP 374
+
+
+>tpe|CAE51415.1| TPA: serine proteinase inhibitor B3-like 1 precursor [Mus musculus]
+          Length = 387
+
+ Score =  131 bits (330), Expect = 1e-029
+ Identities = 64/161 (39%), Positives = 103/161 (63%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KI+E+P+   +LSM VLLP E+  L+++E+ +  +KL +WT    M    + + LPQ K+
+Sbjct: 227 KIVEIPYKGKELSMFVLLPVEIDGLKKVEEQLTADKLLQWTRAENMHMTELYLSLPQFKV 286
+
+Query: 63  EEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EEKY+L   L  +GM D F P  A+ +G+S+++ L +S+ +H +F+E++E+G E A +
+Sbjct: 287 EEKYDLRVPLEHMGMVDAFDPQKADFSGMSNSQGLVVSKVLHKSFVEVNEEGAEAATAMS 346
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V       P+   F  +HPFLF++K N TN+I++FGR  SP
+Sbjct: 347 VESRSLSVPKPNDFSCNHPFLFVMKQNKTNSILFFGRVSSP 387
+
+
+>ref|XP_001365469.1| PREDICTED: similar to gag-protease [Monodelphis domestica]
+          Length = 375
+
+ Score =  131 bits (329), Expect = 1e-029
+ Identities = 68/168 (40%), Positives = 112/168 (66%), Gaps = 15/168 (8%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVYLP 58
+           KI+ELPF +  LSML++LP +V D    LE+IEK ++ E L EWTNP+TM   +VK+ +P
+Sbjct: 215 KIIELPFQNKHLSMLIILPKDVEDDSTGLEKIEKDLSLETLQEWTNPSTMASTKVKLSIP 274
+
+Query: 59  QMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDG---I 114
+           + K+E+  +  +VL +LGM ++F  S ++ +G+S  + + +S  +H   +E++EDG   I
+Sbjct: 275 KFKVEKIVDPKTVLESLGMKNVFDESTSDFSGLSETKGVALSNVIHRTCLEITEDGGDSI 334
+
+Query: 115 EMAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           E+ GS      ++H    ++F ADHPF+++I+HN T  I++FG++ SP
+Sbjct: 335 EVPGS----RILQH---KDEFNADHPFIYIIRHNKTRNIIFFGKFCSP 375
+
+
+>gb|AAH81162.1| MGC84275 protein [Xenopus laevis]
+          Length = 392
+
+ Score =  131 bits (329), Expect = 1e-029
+ Identities = 70/163 (42%), Positives = 105/163 (64%), Gaps = 3/163 (1%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           K +ILELP+  G  SM ++LPD++  L  +E  + +EKLT+  N   + + +V V LPQ
+Sbjct: 230 KCRILELPYEEG-FSMKIILPDDIDGLAELEANLTYEKLTKLMNLENIREVKVVVRLPQF 288
+
+Query: 61  KIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGST 120
+           K  E Y+L  VL ++GMT +F   A+L+GIS   SL IS  +H +F+E++E+G E A +T
+Sbjct: 289 KFGETYSLKEVLKSMGMTSVF-QGADLSGISDKVSLVISTVIHKSFIEVNEEGTEAAAAT 347
+
+Query: 121 GVIEDIKHSP-ESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           G+   +   P   E+F ADHPFL  I+HN T ++++FGR+ SP
+Sbjct: 348 GIGIVVTSLPLPPEEFVADHPFLLTIEHNQTKSMLFFGRFTSP 390
+
+
+>gb|AAI17992.1| Serpinb13 protein [Mus musculus]
+          Length = 178
+
+ Score =  130 bits (328), Expect = 2e-029
+ Identities = 60/160 (37%), Positives = 104/160 (65%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KI+ +P+ + D+SM VLLP+++  LE+I   ++ EKL EWT+P  +E+RRV + LP++++
+Sbjct: 19  KIVGIPYKNNDISMFVLLPNDIDGLEKIMDKMSPEKLVEWTSPGHLEQRRVDLRLPRLQV 78
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L  VL A+G+   F   A+ +G+S+   L     +H +F+ ++E+G+E    TGV
+Sbjct: 79  EETYDLEPVLEAVGIHSAFSEHADYSGMSARSGLHAQNFLHRSFLVVTEEGVEATAGTGV 138
+
+Query: 123 IEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+              +  +   E    +HPFLF I+H  +++I++FG++ SP
+Sbjct: 139 GLKVSSAASCELVHCNHPFLFFIRHRESDSILFFGKFSSP 178
+
+
+>gb|AAI17991.1| Serine (or cysteine) peptidase inhibitor, clade B (ovalbumin),
+           member 13 [Mus musculus]
+          Length = 389
+
+ Score =  130 bits (328), Expect = 2e-029
+ Identities = 60/160 (37%), Positives = 104/160 (65%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KI+ +P+ + D+SM VLLP+++  LE+I   ++ EKL EWT+P  +E+RRV + LP++++
+Sbjct: 230 KIVGIPYKNNDISMFVLLPNDIDGLEKIMDKMSPEKLVEWTSPGHLEQRRVDLRLPRLQV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L  VL A+G+   F   A+ +G+S+   L     +H +F+ ++E+G+E    TGV
+Sbjct: 290 EETYDLEPVLEAVGIHSAFSEHADYSGMSARSGLHAQNFLHRSFLVVTEEGVEATAGTGV 349
+
+Query: 123 IEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+              +  +   E    +HPFLF I+H  +++I++FG++ SP
+Sbjct: 350 GLKVSSAASCELVHCNHPFLFFIRHRESDSILFFGKFSSP 389
+
+
+>ref|XP_001254828.1| PREDICTED: similar to SERPINB3 [Bos taurus]
+          Length = 147
+
+ Score =  130 bits (327), Expect = 2e-029
+ Identities = 64/137 (46%), Positives = 89/137 (64%), Gaps = 1/137 (0%)
+
+Query: 27  LERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTSVLMALGMTDLFIPS-A 85
+           L ++E  +  EKL EWT+P  M  R V +YLP+ K+EE YNL   L ALGM D F    A
+Sbjct: 11  LLQVEDQLTAEKLIEWTSPQNMGNREVDLYLPRFKVEESYNLVPTLQALGMVDAFCGGVA 70
+
+Query: 86  NLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHPFLFLI 145
+           N +G++ +  L +S+ +H +F+E++E+G E A +TGV+      P  E+FR DHPFLFLI
+Sbjct: 71  NFSGMNGSRDLAVSKVIHKSFVEVTEEGTEAAAATGVVFTRTSLPFRERFRCDHPFLFLI 130
+
+Query: 146 KHNPTNTIVYFGRYWSP 162
+           KH  TN+I++ GR  SP
+Sbjct: 131 KHIKTNSILFCGRVSSP 147
+
+
+>ref|NP_958764.1| serine (or cysteine) proteinase inhibitor, clade b, member 3d [Mus
+           musculus]
+ gb|AAR89290.1| serpinb3d [Mus musculus]
+          Length = 387
+
+ Score =  130 bits (327), Expect = 2e-029
+ Identities = 64/161 (39%), Positives = 102/161 (63%), Gaps = 1/161 (0%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KI+E+P+   +LSM VLLP E+  L++ E+ +  +KL +WT    M    + + LPQ K+
+Sbjct: 227 KIVEIPYKGKELSMFVLLPVEIDGLKKFEEQLTADKLLQWTRAENMHMTELYLSLPQFKV 286
+
+Query: 63  EEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EEKY+L   L  +GM D F P  A+ +G+S+++ L +S+ +H +F+E++E+G E A +
+Sbjct: 287 EEKYDLRVPLEHMGMVDAFDPQKADFSGMSNSQGLVVSKVLHKSFVEVNEEGAEAATAMS 346
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           V       P+   F  +HPFLF++K N TN+I++FGR  SP
+Sbjct: 347 VESRSLSVPKPNDFSCNHPFLFVMKQNKTNSILFFGRVSSP 387
+
+
+>ref|NP_001007932.1| serpinb8 protein [Xenopus tropicalis]
+ gb|AAH80439.1| Serpinb8 protein [Xenopus tropicalis]
+ gb|AAI21565.1| Serpinb8 protein [Xenopus tropicalis]
+          Length = 379
+
+ Score =  130 bits (327), Expect = 2e-029
+ Identities = 62/165 (37%), Positives = 108/165 (65%), Gaps = 5/165 (3%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVYLP 58
+           K++E+P+   +LSM++LLPD+++D    LE +EK + +EK  +WTNP  M+   +++ LP
+Sbjct: 215 KVVEIPYVDNELSMIILLPDDINDGTTGLEALEKELTYEKFLKWTNPEMMDITEMELSLP 274
+
+Query: 59  QMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMA 117
+           + K+E+ Y+L S L  +GM+D F    A+ +G+SSA  L +S+ +H +F++++E+G E A
+Sbjct: 275 KFKLEDDYDLESFLSTMGMSDAFDQRRADFSGMSSANDLFLSKVLHKSFVDVNEEGTEAA 334
+
+Query: 118 GSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            +T  I  ++ +    +   DHPFLF I H P+ +I++ GR+  P
+Sbjct: 335 AATAAIMMLRCAMIIPRIVCDHPFLFFILHRPSQSILFCGRFALP 379
+
+
+>ref|NP_001011282.1| serine (or cysteine) proteinase inhibitor, clade B, member 5
+           [Xenopus tropicalis]
+ gb|AAH87996.1| Serine (or cysteine) proteinase inhibitor, clade B, member 5
+           [Xenopus tropicalis]
+          Length = 379
+
+ Score =  130 bits (326), Expect = 3e-029
+ Identities = 66/167 (39%), Positives = 103/167 (61%), Gaps = 9/167 (5%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K  +LE+PF S   SML+LLP ++ D    L+++E+ + FEK T WTNP+ M   +VKV
+Sbjct: 213 KTMVLEMPFQSKHFSMLILLPKDIEDDSTGLKKLEQDMTFEKYTHWTNPSMMANSKVKVS 272
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPSA-NLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           LP+ K+E  Y+L  +L +LG+ D F   A + + ++ ++ + ISQA+  A +E+ EDG E
+Sbjct: 273 LPKFKMENSYDLKDMLKSLGINDAFNEEASDFSEMTESKGISISQAIQKACIEVDEDGTE 332
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A     +   +     E+F ADHPF+++++HN T TI+  GRY  P
+Sbjct: 333 SAD----VSMERRLMNKEEFLADHPFIYILRHNKTRTIIMLGRYCGP 375
+
+
+>ref|XP_871118.2| PREDICTED: similar to thrombin inhibitor [Bos taurus]
+          Length = 378
+
+ Score =  129 bits (325), Expect = 4e-029
+ Identities = 65/163 (39%), Positives = 103/163 (63%), Gaps = 5/163 (3%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +IL LP+   +L+M++LLP E +DL  +EK + +EK   WT P+ M++  V+V+LP+  +
+Sbjct: 218 QILVLPYVGQELNMVILLPSERTDLNMVEKALTYEKFIAWTKPDVMDEEEVEVFLPRFTL 277
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EE Y++   L  LGMTD F  + A+  G+SS   L +S+ +H + +E++E+G E   +TG
+Sbjct: 278 EESYDMEEFLRELGMTDAFEEARADFRGMSSWRGLHLSKVIHKSLVEVTEEGTEAVAATG 337
+
+Query: 122 VIEDIKHSPES--EQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+             ED+     +    F ADHPFLF I+H+ T  I++ GR+ SP
+Sbjct: 338 --EDVMTGSLTTIPMFYADHPFLFFIQHSRTGAILFCGRFCSP 378
+
+
+>ref|NP_035585.1| serine (or cysteine) proteinase inhibitor, clade B, member 9g [Mus
+           musculus]
+ dbj|BAB23998.1| unnamed protein product [Mus musculus]
+          Length = 377
+
+ Score =  129 bits (325), Expect = 4e-029
+ Identities = 65/161 (40%), Positives = 105/161 (65%), Gaps = 2/161 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           ++L +P+   DL+ +VLLPDE  D+ ++E  + FEKLT WT P  M +    VYLP+ ++
+Sbjct: 216 QVLVMPYEGIDLNFVVLLPDEGVDISKVENNLTFEKLTAWTKPEFMNRTEFHVYLPKFQL 275
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           +E Y++ S+L  LG+ ++F  S A+L+G+S+ E+L +S+  H   +E++E+G E A ++
+Sbjct: 276 QEDYDMNSLLQHLGILNVFDGSKADLSGMSTKENLCLSEFAHKCVVEVNEEGTEAAAASA 335
+
+Query: 122 V-IEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWS 161
+           V    +   P+ E F ADHPFLF I H  TN+I++ GR+ S
+Sbjct: 336 VKFIFLCSGPDPETFCADHPFLFFIMHRTTNSILFCGRFSS 376
+
+
+>ref|NP_033282.1| serine (or cysteine) proteinase inhibitor, clade B, member 9 [Mus
+           musculus]
+ gb|AAB57812.1| SPI6 [Mus musculus]
+ gb|AAH29900.1| Serine (or cysteine) peptidase inhibitor, clade B, member 9 [Mus
+           musculus]
+ dbj|BAC29128.1| unnamed protein product [Mus musculus]
+ emb|CAI25479.1| serine protease inhibitor 6 [Mus musculus]
+ dbj|BAE36475.1| unnamed protein product [Mus musculus]
+          Length = 374
+
+ Score =  129 bits (324), Expect = 5e-029
+ Identities = 65/161 (40%), Positives = 106/161 (65%), Gaps = 2/161 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           ++L +P+   +LS++VLLPDE  DL ++E  + FEKLT W   + M+   V+V+LP+ K+
+Sbjct: 215 QVLVMPYEGMELSLVVLLPDEGVDLSKVENNLTFEKLTAWMEADFMKSTDVEVFLPKFKL 274
+
+Query: 63  EEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           +E Y++ S+   LG+ D+F    A+L+G+S   +L +S+ VH + +E++E+G E A ++
+Sbjct: 275 QEDYDMESLFQRLGVVDVFQEDKADLSGMSPERNLCVSKFVHQSVVEINEEGTEAAAASA 334
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           +IE    S     F ADHPFLF I+HN  N+I++ GR+ SP
+Sbjct: 335 IIEFCCAS-SVPTFCADHPFLFFIRHNKANSILFCGRFSSP 374
+
+
+>ref|XP_581432.2| PREDICTED: similar to plasminogen activator inhibitor isoform 1
+           [Bos taurus]
+          Length = 416
+
+ Score =  129 bits (324), Expect = 5e-029
+ Identities = 69/167 (41%), Positives = 108/167 (64%), Gaps = 6/167 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K++ILELP+A G++SM +LLPD +++    LE +E  I  +KL++W + +TM +  V+VY
+Sbjct: 251 KVQILELPYA-GEVSMFLLLPDGIAESSTGLELLESEITPDKLSKWLSEDTMGEDDVEVY 309
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           +P+ K+EE+Y L ++L  +GM D F    AN +G+S    L +S+  H A ++++E+G E
+Sbjct: 310 IPRFKLEERYGLKTILTGMGMGDAFSQGRANFSGMSEKNDLFLSEVFHQASVDVNEEGTE 369
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            A  TG I   +      QF ADHPFLF I H  T +I+++GR+ SP
+Sbjct: 370 AAAGTGAIVTGRTGHGGPQFVADHPFLFFIVHKITKSILFWGRFASP 416
+
+
+>ref|NP_476449.1| serine (or cysteine) proteinase inhibitor, clade B, member 5
+           [Rattus norvegicus]
+ sp|P70564|SPB5_RAT Serpin B5 precursor (Maspin) (Protease inhibitor 5)
+ gb|AAB06043.1| maspin [Rattus norvegicus]
+          Length = 375
+
+ Score =  129 bits (324), Expect = 5e-029
+ Identities = 69/168 (41%), Positives = 110/168 (65%), Gaps = 15/168 (8%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVYLP 58
+           KI+ELPF +  LSML++LP +V D    LE+IEK +N E L +WTNP+TM   +VK+ LP
+Sbjct: 215 KIIELPFQNKHLSMLIVLPKDVEDESTGLEKIEKQLNPETLLQWTNPSTMANAKVKLSLP 274
+
+Query: 59  QMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDG---I 114
+           + K+E+  +  + L +LG+  LF  S ++ +G+S  + + +S  +H   +E++EDG   I
+Sbjct: 275 KFKVEKMIDPKASLESLGLKSLFNESTSDFSGMSETKGVSVSNVIHRVCLEITEDGGDSI 334
+
+Query: 115 EMAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           E+ GS      ++H    ++F+ADHPFLF+++HN T  IV+ G++ SP
+Sbjct: 335 EVPGS----RILQH---KDEFKADHPFLFIVRHNKTRNIVFLGKFSSP 375
+
+
+>gb|AAI32092.1| Serpinb3c protein [Mus musculus]
+          Length = 386
+
+ Score =  129 bits (323), Expect = 6e-029
+ Identities = 66/161 (40%), Positives = 103/161 (63%), Gaps = 2/161 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +I+E+P+   +LSM VLLP E+  L+++EK +   KL EWT    M    + ++LP+ K+
+Sbjct: 227 QIVEIPYKGKELSMFVLLPMEIDGLKQLEKQLTAAKLLEWTRAENMHLTELYLWLPRFKV 286
+
+Query: 63  EEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EEKY+L   L  +GM + F P  A+ +G+SS + L +S+ +H +F+E++E+G E   ++G
+Sbjct: 287 EEKYDLPVPLECMGMVNAFDPQKADFSGMSSTQGLVVSKVLHKSFVEVNEEGTEADPASG 346
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+             E I    +   FR DHPFLF I H+ TN+I++FGR  SP
+Sbjct: 347 E-EVILRLAQVADFRCDHPFLFFIIHSKTNSILFFGRISSP 386
+
+
+>ref|NP_958751.1| serine (or cysteine) proteinase inhibitor, clade B, member 3C [Mus
+           musculus]
+ gb|AAR89289.1| serpinb3c [Mus musculus]
+          Length = 386
+
+ Score =  129 bits (323), Expect = 6e-029
+ Identities = 66/161 (40%), Positives = 103/161 (63%), Gaps = 2/161 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           +I+E+P+   +LSM VLLP E+  L+++EK +   KL EWT    M    + ++LP+ K+
+Sbjct: 227 QIVEIPYKGKELSMFVLLPMEIDGLKQLEKQLTAAKLLEWTRAENMHLTELYLWLPRFKV 286
+
+Query: 63  EEKYNLTSVLMALGMTDLFIP-SANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTG 121
+           EEKY+L   L  +GM + F P  A+ +G+SS + L +S+ +H +F+E++E+G E   ++G
+Sbjct: 287 EEKYDLPVPLECMGMVNAFDPQKADFSGMSSTQGLVVSKVLHKSFVEVNEEGTEADPASG 346
+
+Query: 122 VIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+             E I    +   FR DHPFLF I H+ TN+I++FGR  SP
+Sbjct: 347 E-EVILRLAQVADFRCDHPFLFFIIHSKTNSILFFGRISSP 386
+
+
+>gb|AAB57813.1| serine proteinase inhibitor mBM2A [Mus musculus]
+          Length = 187
+
+ Score =  129 bits (323), Expect = 6e-029
+ Identities = 67/162 (41%), Positives = 107/162 (66%), Gaps = 3/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           ++L +P+   +LS +VLLPD ++ L ++E  + FEKLT WTNP+ M+   V+V+LP+ K+
+Sbjct: 27  QVLTMPYEGMELSFVVLLPDNLTGLSKVESNLTFEKLTAWTNPDFMKNTNVEVFLPKFKL 86
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVH-GAFMELSEDGIEMAGST 120
+           +E Y++ SV   LG+ D+F  + A+L+ +S   +L +S+ VH    +E++E+G E A ++
+Sbjct: 87  QEDYDMESVFQRLGIVDVFQEAKADLSAMSPERNLCVSKIVHKRGVVEVNEEGTEAAAAS 146
+
+Query: 121 GVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            VIE    +     F ADHPFLF IKHN T +I++ GR+ SP
+Sbjct: 147 AVIE-YCCAAFVPTFCADHPFLFFIKHNKTKSILFCGRFSSP 187
+
+
+>gb|AAH10313.1| Serine (or cysteine) peptidase inhibitor, clade B (ovalbumin),
+           member 11 [Mus musculus]
+          Length = 388
+
+ Score =  129 bits (323), Expect = 6e-029
+ Identities = 63/163 (38%), Positives = 111/163 (68%), Gaps = 2/163 (1%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           +M++LELP+A+  L M++LLP   + + +IEK +N + L EWTNP+ M +R V V++P+
+Sbjct: 227 EMQVLELPYANNKLRMIILLPVGTASVSQIEKHLNVKMLREWTNPSNMVEREVDVHIPKF 286
+
+Query: 61  KIEEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGS 119
+            +  KY+L ++L +LGM D+F + +A+L+G+S  + L +S+ VH ++++++E+G E A +
+Sbjct: 287 SLSVKYDLNTLLKSLGMRDIFNVANADLSGMSPDKGLYLSKVVHKSYVDVNEEGTEAAAA 346
+
+Query: 120 TGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           TG    +K  P + QF A+ PFLF I  + +  I++ G++ SP
+Sbjct: 347 TGESISVKRLPVTVQFTANCPFLFFI-WDESGNILFAGKFASP 388
+
+
+>ref|NP_080143.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 11 [Mus musculus]
+ sp|Q9CQV3|SPB11_MOUSE Serpin B11
+ dbj|BAB26017.1| unnamed protein product [Mus musculus]
+ dbj|BAB26546.1| unnamed protein product [Mus musculus]
+ gb|AAR89286.1| serpinb11 [Mus musculus]
+          Length = 388
+
+ Score =  129 bits (323), Expect = 6e-029
+ Identities = 63/163 (38%), Positives = 111/163 (68%), Gaps = 2/163 (1%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQM 60
+           +M++LELP+A+  L M++LLP   + + +IEK +N + L EWTNP+ M +R V V++P+
+Sbjct: 227 EMQVLELPYANNKLRMIILLPVGTASVSQIEKHLNVKMLREWTNPSNMVEREVDVHIPKF 286
+
+Query: 61  KIEEKYNLTSVLMALGMTDLF-IPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGS 119
+            +  KY+L ++L +LGM D+F + +A+L+G+S  + L +S+ VH ++++++E+G E A +
+Sbjct: 287 SLSVKYDLNTLLKSLGMRDIFNVANADLSGMSPDKGLYLSKVVHKSYVDVNEEGTEAAAA 346
+
+Query: 120 TGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           TG    +K  P + QF A+ PFLF I  + +  I++ G++ SP
+Sbjct: 347 TGESISVKRLPVTVQFTANCPFLFFI-WDESGNILFAGKFASP 388
+
+
+>ref|NP_035590.1| serine (or cysteine) proteinase inhibitor, clade B, member 9d [Mus
+           musculus]
+ dbj|BAC25920.1| unnamed protein product [Mus musculus]
+ emb|CAI25618.1| novel serine protease inhibitor (Spi) family member [Mus musculus]
+          Length = 377
+
+ Score =  128 bits (322), Expect = 8e-029
+ Identities = 67/162 (41%), Positives = 105/162 (64%), Gaps = 2/162 (1%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           ++L +P+   DLS +VLLPD+  D+ ++E  + FEKLT WT P+ M    + VYLP+ ++
+Sbjct: 216 QVLVMPYEGIDLSFVVLLPDKGVDISKVENNLTFEKLTAWTKPDFMNGIELHVYLPKFQL 275
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGST- 120
+           +E Y++ S+L  LG+ D+F  S A+L+G+S+ E+L +S  VH   +E++E+G E A +T
+Sbjct: 276 QEDYDMNSLLQHLGILDVFDGSKADLSGMSTKENLCLSNFVHKCVVEVNEEGTEAAAATA 335
+
+Query: 121 GVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           G           + F ADHPFLF I H+ TN+I++ GR+ SP
+Sbjct: 336 GKTIQCCLGSYPQTFCADHPFLFFIMHSTTNSILFCGRFSSP 377
+
+
+>gb|AAB57814.1| serine proteinase inhibitor mBM17 [Mus musculus]
+          Length = 146
+
+ Score =  128 bits (322), Expect = 8e-029
+ Identities = 60/143 (41%), Positives = 98/143 (68%), Gaps = 1/143 (0%)
+
+Query: 21  PDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTSVLMALGMTDL 80
+           PDE SDL  +EK + +EKL  WTNP T+ + +V+V+ P++K+EE Y+L +VL +LGMTD
+Sbjct: 4   PDESSDLTVVEKALTYEKLRAWTNPETLTESKVQVFFPRLKLEESYDLETVLQSLGMTDA 63
+
+Query: 81  FIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADH 139
+           F  + A+ +G++S +++++S+  H  F+E++E+G E A +T VI + +      +F  D
+Sbjct: 64  FEETKADFSGMTSKKNVRVSKVAHKCFVEVNEEGTEAAATTAVIRNTRSCRIEPRFCRDR 123
+
+Query: 140 PFLFLIKHNPTNTIVYFGRYWSP 162
+           PFLF I H  T++I++ GR+ SP
+Sbjct: 124 PFLFFIWHQKTSSILFCGRFSSP 146
+
+
+>ref|NP_766440.1| serine (or cysteine) proteinase inhibitor, clade B (ovalbumin),
+           member 13 [Mus musculus]
+ sp|Q8CDC0|SPB13_MOUSE Serpin B13
+ dbj|BAC27072.1| unnamed protein product [Mus musculus]
+          Length = 389
+
+ Score =  128 bits (322), Expect = 8e-029
+ Identities = 59/160 (36%), Positives = 103/160 (64%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KI+ +P+ + D+SM VLLP+++  LE+I   ++ EKL EWT+P  +E+RRV + LP++++
+Sbjct: 230 KIVGIPYKNNDISMFVLLPNDIDGLEKIMDKMSPEKLVEWTSPGHLEQRRVDLRLPRLQV 289
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+   VL A+G+   F   A+ +G+S+   L     +H +F+ ++E+G+E    TGV
+Sbjct: 290 EETYDQEPVLEAVGIHSAFSEHADYSGMSARSGLHAQNFLHRSFLVVTEEGVEATAGTGV 349
+
+Query: 123 IEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+              +  +   E    +HPFLF I+H  +++I++FG++ SP
+Sbjct: 350 GLKVSSAASCELVHCNHPFLFFIRHRESDSILFFGKFSSP 389
+
+
+>ref|XP_222497.2| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B (ovalbumin), member 13 [Rattus norvegicus]
+ ref|XP_001064253.1| PREDICTED: similar to serine (or cysteine) proteinase inhibitor,
+           clade B (ovalbumin), member 13 [Rattus norvegicus]
+          Length = 435
+
+ Score =  128 bits (321), Expect = 1e-028
+ Identities = 58/160 (36%), Positives = 103/160 (64%)
+
+Query: 3   KILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKI 62
+           KI+ +P+ + D SM VLLP+++  LE+I   ++ EKL EWT+P  +++R+V + LP++K+
+Sbjct: 276 KIVGIPYKNSDFSMFVLLPNDIDGLEKIIDKLSPEKLVEWTSPGQLKQRKVDLRLPRLKV 335
+
+Query: 63  EEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGV 122
+           EE Y+L   L A+G+   F   A+ +G+S+   L+    +H +F+ ++E+G+E    TGV
+Sbjct: 336 EETYDLQPTLEAVGIHSAFSEHADYSGMSAHSGLQTQNFLHRSFLVVTEEGVEATAGTGV 395
+
+Query: 123 IEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+              +  +   E    +HPFLF ++H  +++I++FGR+ SP
+Sbjct: 396 GFKVLSAASCELVHCNHPFLFFVRHRESDSILFFGRFSSP 435
+
+
+>emb|CAA04047.1| serpin [Mus musculus]
+          Length = 415
+
+ Score =  128 bits (321), Expect = 1e-028
+ Identities = 68/167 (40%), Positives = 104/167 (62%), Gaps = 6/167 (3%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVSD----LERIEKTINFEKLTEWTNPNTMEKRRVKVY 56
+           K +ILELP+  G++SML+LLPDE+ D    LE +E+ INF    +W + +T+++  V VY
+Sbjct: 250 KTQILELPYI-GNISMLLLLPDEIEDASTGLELLEREINFANFNKWISKDTLDEDDVVVY 308
+
+Query: 57  LPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGIE 115
+           +P+ K+ + Y L S+L ++GM D F    AN +G+S    L +S+  H A ++++E+G
+Sbjct: 309 IPKFKLAQSYELKSILQSMGMEDAFNKGKANFSGMSERNDLFLSEVFHQASVDVTEEGTV 368
+
+Query: 116 MAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+            AG TG +   +      QF ADHPFLF I    T+TI++ GR+ SP
+Sbjct: 369 AAGGTGAVMTGRTGHGGPQFVADHPFLFFIMDKITHTILFVGRFSSP 415
+
+
+>ref|NP_001038636.1| hypothetical protein LOC568898 [Danio rerio]
+ emb|CAI20745.1| novel protein similar to vertebrate serine (or cysteine) proteinase
+           inhibitor, clade B (ovalbumin), member 1 (SERPINB1)
+           [Danio rerio]
+          Length = 382
+
+ Score =  127 bits (320), Expect = 1e-028
+ Identities = 68/169 (40%), Positives = 111/169 (65%), Gaps = 7/169 (4%)
+
+Query: 1   KMKILELPFASGDLSMLVLLPDEVS----DLERIEKTINFEKLTEWTNPNTMEK-RRVKV 55
+           K+++LELP+   +LSML+LLPDE+      L ++E  +N +KL +WT+   M+  R++ V
+Sbjct: 213 KLQVLELPYTQQELSMLILLPDEIKYGSDPLLKLESELNLQKLLDWTSRGKMDTWRKIIV 272
+
+Query: 56  YLPQMKIEEKYNLTSVLMALGMTDLFIPS-ANLTGISSAESLKISQAVHGAFMELSEDGI 114
+            LP+ K+E +  L+  L  +GM+ +F  + A+LTG+SS   L +S  +H AF+E++E+G
+Sbjct: 273 RLPKFKLEIESCLSETLEKMGMSSVFQETKADLTGMSSNGGLFLSAVIHKAFVEVNEEGT 332
+
+Query: 115 EMAGSTGVIEDIKHSPES-EQFRADHPFLFLIKHNPTNTIVYFGRYWSP 162
+           E A +T ++  I     +   F ADHPF+F I+HNPTN+I++ GR+ +P
+Sbjct: 333 EAAAATALLLPISACQGAFHDFIADHPFMFFIRHNPTNSILFLGRFRAP 381
+
+
+  Database: All non-redundant GenBank CDS
+  translations+PDB+SwissProt+PIR+PRF excluding environmental samples
+  from WGS projects
+    Posted date:  May 9, 2007  5:55 PM
+  Number of letters in database: 1,693,139,330
+  Number of sequences in database:  4,904,269
+
+Lambda     K      H
+   0.317    0.134    0.000
+
+Gapped
+Lambda     K      H
+   0.267   0.0410 4.94e-324
+
+Matrix: BLOSUM62
+Gap Penalties: Existence: 11, Extension: 1
+Number of Sequences: 4904269
+Number of Hits to DB: 25170198
+Number of extensions: 908483
+Number of successful extensions: 2591
+Number of sequences better than 10: 18
+Number of HSP's better than 10 without gapping: 0
+Number of HSP's gapped: 2611
+Number of HSP's successfully gapped: 18
+Length of query: 162
+Length of database: 1693139330
+Length adjustment: 121
+Effective length of query: 41
+Effective length of database: 1099722781
+Effective search space: 45088634021
+Effective search space used: 45088634021
+T: 11
+A: 40
+X1: 16 (7.3 bits)
+X2: 38 (14.6 bits)
+X3: 64 (24.7 bits)
+S1: 41 (20.4 bits)
+S2: 72 (32.3 bits)
+
diff --git a/geneWKspace/Genetegrate/ClientCopy3.blastpgp b/geneWKspace/Genetegrate/ClientCopy3.blastpgp
new file mode 100644
index 0000000..562a8c4
--- /dev/null
+++ b/geneWKspace/Genetegrate/ClientCopy3.blastpgp
@@ -0,0 +1,20 @@
+BLASTP 2.2.15 [Oct-15-2006]
+
+
+Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
+Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
+"Gapped BLAST and PSI-BLAST: a new generation of protein database search
+programs",  Nucleic Acids Res. 25:3389-3402.
+
+Query= fasta4
+         (138 letters)
+
+Database: All non-redundant GenBank CDS
+translations+PDB+SwissProt+PIR+PRF excluding environmental samples
+from WGS projects
+           4,904,269 sequences; 1,693,139,330 total letters
+
+
+
+ ***** No hits found ******
+
diff --git a/geneWKspace/Genetegrate/ClientCopy4.blastpgp b/geneWKspace/Genetegrate/ClientCopy4.blastpgp
new file mode 100644
index 0000000..6c3ec28
--- /dev/null
+++ b/geneWKspace/Genetegrate/ClientCopy4.blastpgp
@@ -0,0 +1,1184 @@
+BLASTP 2.2.15 [Oct-15-2006]
+
+
+Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
+Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
+"Gapped BLAST and PSI-BLAST: a new generation of protein database search
+programs",  Nucleic Acids Res. 25:3389-3402.
+
+Query= fasta5
+         (138 letters)
+
+Database: All non-redundant GenBank CDS
+translations+PDB+SwissProt+PIR+PRF excluding environmental samples
+from WGS projects
+           4,904,269 sequences; 1,693,139,330 total letters
+
+
+
+                                                                 Score    E
+Sequences producing significant alignments:                      (bits) Value
+
+ref|XP_001311998.1| conserved hypothetical protein [Trichomonas ...    38   0.18
+ref|XP_453995.1| unnamed protein product [Kluyveromyces lactis] ...    37   0.40
+ref|XP_001310030.1| conserved hypothetical protein [Trichomonas ...    36   0.53
+ref|NP_373178.1| serine-threoinine rich antigen [Staphylococcus ...    36   0.53
+sp|Q8VQ99|SRAP_STAAU Serine-rich adhesin for platelets precursor...    36   0.69
+ref|XP_001187428.1| PREDICTED: hypothetical protein [Strongyloce...    35   0.90
+ref|XP_001179970.1| PREDICTED: hypothetical protein, partial [St...    35   0.90
+ref|YP_501439.1| hypothetical protein SAOUHSC_02990 [Staphylococ...    35   1.2
+ref|YP_495223.1| LPXTG-motif cell wall surface anchor family pro...    35   1.2
+ref|YP_187464.1| LPXTG cell wall surface anchor family protein [...    35   1.2
+ref|YP_044654.1| putative cell wall-anchored protein [Staphyloco...    35   1.2
+ref|NP_647392.1| hypothetical protein MW2575 [Staphylococcus aur...    35   1.2
+gb|AAO84907.1| extracellular matrix protein papilin 2 [Drosophil...    35   1.5
+gb|AAG37995.1|AF205357_1 extracellular matrix protein papilin [D...    35   1.5
+gb|AAO84908.1| extracellular matrix protein papilin 3 [Drosophil...    35   1.5
+ref|NP_648831.1| CG13075-PA [Drosophila melanogaster] >gi|729419...    35   1.5
+gb|AAG00554.1|AF286475_1 retinitis pigmentosa GTPase regulator-l...    34   2.0
+gb|ABE91554.2| TonB box, N-terminal [Medicago truncatula]              34   2.6
+gb|AAQ09848.1| CG10911 [Drosophila yakuba]                             34   2.6
+ref|YP_042074.1| putative serine rich repeat containing protein ...    33   3.4
+sp|Q868Z9|PPN_DROME Papilin precursor                                  33   4.5
+ref|NP_788751.1| Papilin CG33103-PB, isoform B [Drosophila melan...    33   4.5
+ref|NP_648504.2| CG6004-PB [Drosophila melanogaster] >gi|1844719...    33   4.5
+ref|NP_788752.1| Papilin CG33103-PA, isoform A [Drosophila melan...    33   4.5
+ref|XP_001384983.1| predicted protein [Pichia stipitis CBS 6054]...    33   5.8
+gb|AAH75165.1| LOC443724 protein [Xenopus laevis]                      33   5.8
+gb|AAF87093.1|AF167576_1 secreted antigen SagBb [Enterococcus hi...    33   5.8
+gb|AAI10711.1| LOC443724 protein [Xenopus laevis]                      33   5.8
+ref|XP_847865.1| hypothetical protein LMJ_0842 [Leishmania major...    33   5.8
+gb|AAH94141.1| LOC443724 protein [Xenopus laevis]                      33   5.8
+ref|YP_189831.1| serine threonine rich antigen [Staphylococcus e...    33   5.8
+ref|NP_765804.1| streptococcal hemagglutinin protein [Staphyloco...    32   7.6
+ref|NP_611286.1| CG10911-PA [Drosophila melanogaster] >gi|730268...    32   7.6
+ref|YP_394895.1| Hypothetical lipoprotein precursor [Lactobacill...    32   7.6
+ref|NP_496184.1| Location Of Vulva defective family member (lov-...    32   7.6
+pir||T21460 hypothetical protein ZK945.10 - Caenorhabditis elegans     32   7.6
+ref|XP_001355356.1| GA18086-PA [Drosophila pseudoobscura] >gi|54...    32   7.6
+ref|XP_768937.1| hypothetical protein GLP_561_28660_36852 [Giard...    32   7.6
+ref|XP_001369233.1| PREDICTED: similar to neuron growth-associat...    32   10.0
+ref|YP_696758.1| bacterial extracellular solute-binding protein ...    32   10.0
+ref|XP_453348.1| unnamed protein product [Kluyveromyces lactis] ...    32   10.0
+gb|AAB41404.1| adenomatous polyposis coli [Drosophila melanogaster]    32   10.0
+ref|NP_477152.1| APC-like CG1451-PA [Drosophila melanogaster] >g...    32   10.0
+ref|XP_501626.1| hypothetical protein [Yarrowia lipolytica] >gi|...    32   10.0
+ref|NP_562994.1| hypothetical protein CPE2078 [Clostridium perfr...    32   10.0
+ref|XP_640638.1| hypothetical protein DDBDRAFT_0204669 [Dictyost...    32   10.0
+
+>ref|XP_001311998.1| conserved hypothetical protein [Trichomonas vaginalis G3]
+ gb|EAX99068.1| conserved hypothetical protein [Trichomonas vaginalis G3]
+          Length = 895
+
+ Score = 37.7 bits (86), Expect = 0.18
+ Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 3/74 (4%)
+
+Query: 3   ENETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSD 62
+           E+ T   +TE + +   + +T+ +S S STE S    S T  +  E +T+  S  TE S
+Sbjct: 731 ESSTSTSSTETESSTSTESSTSTSSISTSTESS---TSSTSTSSTESSTLTSSTETESST 787
+
+Query: 63  ATABASESYSTEMS 76
+           +T  ++ S  TE S
+Sbjct: 788 STESSTSSTETESS 801
+
+
+>ref|XP_453995.1| unnamed protein product [Kluyveromyces lactis]
+ emb|CAG99082.1| unnamed protein product [Kluyveromyces lactis NRRL Y-1140]
+          Length = 1878
+
+ Score = 36.6 bits (83), Expect = 0.40
+ Identities = 25/81 (30%), Positives = 34/81 (41%), Gaps = 1/81 (1%)
+
+Query: 3   ENETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSD 62
+           E+ TE   T +DV + E    A  SE+ STE S    +    +         + S+  S
+Sbjct: 574 ESSTEA-ITSSDVTSTESSTEATTSEATSTESSTEATTSDVTSTESPTEATSTESSTSST 632
+
+Query: 63  ATABASESYSTEMSAVANCED 83
+            TA+  E  STE S  A   D
+Sbjct: 633 TTADPQEQTSTESSTEATTSD 653
+
+
+
+ Score = 36.6 bits (83), Expect = 0.40
+ Identities = 24/83 (28%), Positives = 35/83 (42%)
+
+Query: 5   ETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDAT 64
+           E+   AT +DV + E    A  SE+ STE S    +   ++         + S   S  T
+Sbjct: 832 ESSTEATTSDVISTESSTEATTSEATSTESSTEATTSDVISTESSTEATSTESFTSSTTT 891
+
+Query: 65  ABASESYSTEMSAVANCEDSOFT 87
+           A+  E  STE S  A   ++  T
+Sbjct: 892 ADPQEQTSTESSTEAITSEATST 914
+
+
+
+ Score = 33.9 bits (76), Expect = 2.6
+ Identities = 22/80 (27%), Positives = 35/80 (43%)
+
+Query: 5   ETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDAT 64
+           E+   AT +DV + E    A ++ES+++  +     E   T      I    ++  S
+Sbjct: 690 ESSTEATTSDVISTESSTEATSTESFTSSTTTADPQEQTSTESSTEAITSEATSTESSTE 749
+
+Query: 65  ABASESYSTEMSAVANCEDS 84
+           A  SE+ STE S  A   +S
+Sbjct: 750 ATTSEATSTESSTEATSTES 769
+
+
+
+ Score = 33.5 bits (75), Expect = 3.4
+ Identities = 28/80 (35%), Positives = 37/80 (46%), Gaps = 4/80 (5%)
+
+Query: 5    ETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDAT 64
+            E+   AT +DV + E    A ++ES STE S    S    T    AT +   STE S
+Sbjct: 1234 ESSTEATTSDVISTESSTEATSTES-STESSTEATSTESST---EATTSDVISTESSTEA 1289
+
+Query: 65   ABASESYSTEMSAVANCEDS 84
+              +S+  STE S  A   +S
+Sbjct: 1290 ITSSDVTSTESSTEATSTES 1309
+
+
+
+ Score = 33.1 bits (74), Expect = 4.5
+ Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 2/79 (2%)
+
+Query: 6   TEGRATEADVANCEDDATABASESY-STEMSWHIMSETPLTOPERATINGSYSTEMSDAT 64
+           T   AT +DV + E    A ++ES+ S+  +     +T       AT +   STE S
+Sbjct: 792 TTSEATTSDVISTESSTEATSTESFTSSTTTADPQEQTSTESSTEATTSDVISTE-SSTE 850
+
+Query: 65  ABASESYSTEMSAVANCED 83
+           A  SE+ STE S  A   D
+Sbjct: 851 ATTSEATSTESSTEATTSD 869
+
+
+
+ Score = 33.1 bits (74), Expect = 4.5
+ Identities = 26/81 (32%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
+
+Query: 5    ETEGRATEADVANCEDDATABASESY-STEMSWHIMSETPLTOPERATINGSYSTEMSDA 63
+            E+   AT +DV + E    A ++ES+ S+  +     +T       AT + + STE S
+Sbjct: 984  ESSTEATTSDVISTESSTEATSTESFTSSTTTADPQEQTSTESSTEATTSEATSTE-SST 1042
+
+Query: 64   TABASESYSTEMSAVANCEDS 84
+             A  SE+ STE S  A   +S
+Sbjct: 1043 EATTSEATSTESSTEATSTES 1063
+
+
+
+ Score = 33.1 bits (74), Expect = 4.5
+ Identities = 23/82 (28%), Positives = 43/82 (52%), Gaps = 3/82 (3%)
+
+Query: 3    ENETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSD 62
+            E+ TE   T +DV + E    A ++E+ STE S   ++    T    +T + + +T  ++
+Sbjct: 1094 ESSTEA-ITSSDVTSTESSTEATSTEATSTESSTEAITSEATTSEATSTESSTEATTSTE 1152
+
+Query: 63   ATABA--SESYSTEMSAVANCE 82
+            ++ +A  S+  STE S  ++ E
+Sbjct: 1153 SSTEATTSDVISTESSTESSTE 1174
+
+
+
+ Score = 32.7 bits (73), Expect = 5.8
+ Identities = 27/79 (34%), Positives = 35/79 (44%), Gaps = 14/79 (17%)
+
+Query: 5    ETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDAT 64
+            E+   AT +DV + E    A  SE+ STE S              AT +   STE S  T
+Sbjct: 1179 ESSTEATTSDVISTESSTEATTSEATSTESS------------TEATTSDVISTESS--T 1224
+
+Query: 65   ABASESYSTEMSAVANCED 83
+              ++E+ STE S  A   D
+Sbjct: 1225 ESSTEATSTESSTEATTSD 1243
+
+
+
+ Score = 32.3 bits (72), Expect = 7.6
+ Identities = 25/86 (29%), Positives = 37/86 (43%), Gaps = 8/86 (9%)
+
+Query: 3   ENETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEM-- 60
+           E+ TE  +TE+  ++     TA+  E  STE S    +    T    +T + + +T
+Sbjct: 759 ESSTEATSTESSTSST---TTADPQEQTSTESSTEATTSEATTSDVISTESSTEATSTES 815
+
+Query: 61  ---SDATABASESYSTEMSAVANCED 83
+              S  TA+  E  STE S  A   D
+Sbjct: 816 FTSSTTTADPQEQTSTESSTEATTSD 841
+
+
+>ref|XP_001310030.1| conserved hypothetical protein [Trichomonas vaginalis G3]
+ gb|EAX97100.1| conserved hypothetical protein [Trichomonas vaginalis G3]
+          Length = 662
+
+ Score = 36.2 bits (82), Expect = 0.53
+ Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 4/90 (4%)
+
+Query: 1   EGENETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPL---TOPERATINGSYS 57
+           E E+ T   +TE++       +++  SES ++  S    SE+     T  E  T + S S
+Sbjct: 410 ESESTTSSSSTESESTTSSSSSSSTESESTTSSSSSSTESESTTSSSTESESTTSSSSSS 469
+
+Query: 58  TEMSDATABASESYSTEMSAVANCEDSOFT 87
+           TE S++T  +S S STE  + ++   S  T
+Sbjct: 470 TE-SESTTSSSTSTSTESESTSSSSTSTST 498
+
+
+
+ Score = 33.1 bits (74), Expect = 4.5
+ Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 4/80 (5%)
+
+Query: 11  TEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDATABAS-- 68
+           T +  ++ E ++T  +S S STE      S T  +    +T + S STE S++T+ +S
+Sbjct: 463 TSSSSSSTESESTTSSSTSTSTESESTSSSSTSTSTESESTTSSSTSTE-SESTSSSSTS 521
+
+Query: 69  -ESYSTEMSAVANCEDSOFT 87
+            ES ST  S+ ++ E    T
+Sbjct: 522 TESESTTSSSSSSTESESTT 541
+
+
+
+ Score = 32.3 bits (72), Expect = 7.6
+ Identities = 25/86 (29%), Positives = 41/86 (47%), Gaps = 5/86 (5%)
+
+Query: 5   ETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDAT 64
+           E+E   + +   + E ++T+ +S S STE      S T  +    +T + S STE    T
+Sbjct: 471 ESESTTSSSTSTSTESESTSSSSTSTSTESESTTSSST--STESESTSSSSTSTESESTT 528
+
+Query: 65  ABAS---ESYSTEMSAVANCEDSOFT 87
+           + +S   ES ST  S+ ++ E    T
+Sbjct: 529 SSSSSSTESESTTSSSSSSTESESTT 554
+
+
+
+ Score = 32.0 bits (71), Expect = 10.0
+ Identities = 23/79 (29%), Positives = 36/79 (45%), Gaps = 1/79 (1%)
+
+Query: 10  ATEADVANCEDDATABASESYSTEM-SWHIMSETPLTOPERATINGSYSTEMSDATABAS 68
+           +TE++        +   + S STE  S    S +  T  E  T + S STE    T+ ++
+Sbjct: 398 STESESTTSSSTESESTTSSSSTESESTTSSSSSSSTESESTTSSSSSSTESESTTSSST 457
+
+Query: 69  ESYSTEMSAVANCEDSOFT 87
+           ES ST  S+ ++ E    T
+Sbjct: 458 ESESTTSSSSSSTESESTT 476
+
+
+>ref|NP_373178.1| serine-threoinine rich antigen [Staphylococcus aureus subsp. aureus
+            Mu50]
+ ref|NP_375773.1| hypothetical protein SA2447 [Staphylococcus aureus subsp. aureus
+            N315]
+ ref|ZP_01237751.1| Surface protein from Gram-positive cocci, anchor region
+            [Staphylococcus aureus subsp. aureus JH1]
+ ref|ZP_01240413.1| Surface protein from Gram-positive cocci, anchor region
+            [Staphylococcus aureus subsp. aureus JH9]
+ sp|Q7A362|SRAP_STAAN Serine-rich adhesin for platelets precursor (Staphylococcus aureus
+            surface protein A)
+ sp|Q99QY4|SRAP_STAAM Serine-rich adhesin for platelets precursor (Staphylococcus aureus
+            surface protein A)
+ dbj|BAB43752.1| SA2447 [Staphylococcus aureus subsp. aureus N315]
+ dbj|BAB58816.1| serine-threoinine rich antigen [Staphylococcus aureus subsp. aureus
+            Mu50]
+ gb|EAS54421.1| Surface protein from Gram-positive cocci, anchor region
+            [Staphylococcus aureus subsp. aureus JH1]
+ gb|EAS57136.1| Surface protein from Gram-positive cocci, anchor region
+            [Staphylococcus aureus subsp. aureus JH9]
+          Length = 2271
+
+ Score = 36.2 bits (82), Expect = 0.53
+ Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 2/80 (2%)
+
+Query: 5    ETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDAT 64
+            E+E  +    +++ E  +T++ S+S ST  S      T  +  E  + +GS ST +SD+T
+Sbjct: 2039 ESESTSDSTSISDSESLSTSD-SDSTSTSTSDSTSGSTSTSISESLSTSGSGSTSVSDST 2097
+
+Query: 65   ABASESYSTEMSAVANCEDS 84
+            +  SES ST +S   +  DS
+Sbjct: 2098 S-MSESDSTSVSMSQDKSDS 2116
+
+
+
+ Score = 32.0 bits (71), Expect = 10.0
+ Identities = 24/74 (32%), Positives = 40/74 (54%), Gaps = 9/74 (12%)
+
+Query: 4    NETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDA 63
+            N T G A+ +   +  +  +   SES ST +S  + + T L+       + S ST +SD+
+Sbjct: 1253 NSTSGSASISTSTSISESTSTFKSESVSTSLS--MSTSTSLSN------STSLSTSLSDS 1304
+
+Query: 64   TABA-SESYSTEMS 76
+            T+++ S+S ST MS
+Sbjct: 1305 TSDSKSDSLSTSMS 1318
+
+
+>sp|Q8VQ99|SRAP_STAAU Serine-rich adhesin for platelets precursor (Staphylococcus aureus
+            surface protein A)
+ gb|AAL58470.1|AF459093_1 serine-threonine rich antigen [Staphylococcus aureus]
+          Length = 2283
+
+ Score = 35.8 bits (81), Expect = 0.69
+ Identities = 26/80 (32%), Positives = 42/80 (52%), Gaps = 2/80 (2%)
+
+Query: 5    ETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDAT 64
+            E+E  +    +++ E  +T++ S+S ST  S      T  +  E  + +GS ST +SD+T
+Sbjct: 2037 ESESTSDSTSISDSESLSTSD-SDSTSTSTSVSTSGSTSTSVSESLSTSGSGSTSVSDST 2095
+
+Query: 65   ABASESYSTEMSAVANCEDS 84
+            +  SES ST  S   +  DS
+Sbjct: 2096 S-MSESDSTSASMSQDKSDS 2114
+
+
+>ref|XP_001187428.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
+          Length = 819
+
+ Score = 35.4 bits (80), Expect = 0.90
+ Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 6/85 (7%)
+
+Query: 5   ETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDAT 64
+           E E  ATEAD    E D+TA  +++ +TE      ++T  T  +        +    D T
+Sbjct: 459 EAETTATEADTTATEADSTATEADTTATE------ADTTATEADTTATEADTTATEDDTT 512
+
+Query: 65  ABASESYSTEMSAVANCEDSOFTWA 89
+           A  +++ +TE    A   D+  T A
+Sbjct: 513 ATETDTTATEADTTATEADTTATEA 537
+
+
+
+ Score = 33.9 bits (76), Expect = 2.6
+ Identities = 24/89 (26%), Positives = 37/89 (41%), Gaps = 6/89 (6%)
+
+Query: 1   EGENETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEM 60
+           E E      ATEA+    E D TA  ++S +TE      ++T  T  +        +
+Sbjct: 448 EAETTAATTATEAETTATEADTTATEADSTATE------ADTTATEADTTATEADTTATE 501
+
+Query: 61  SDATABASESYSTEMSAVANCEDSOFTWA 89
+           +D TA   ++ +TE    A   D+  T A
+Sbjct: 502 ADTTATEDDTTATETDTTATEADTTATEA 530
+
+
+>ref|XP_001179970.1| PREDICTED: hypothetical protein, partial [Strongylocentrotus
+           purpuratus]
+          Length = 545
+
+ Score = 35.4 bits (80), Expect = 0.90
+ Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 6/85 (7%)
+
+Query: 5   ETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDAT 64
+           E E  ATEAD    E D+TA  +++ +TE      ++T  T  +        +    D T
+Sbjct: 459 EAETTATEADTTATEADSTATEADTTATE------ADTTATEADTTATEADTTATEDDTT 512
+
+Query: 65  ABASESYSTEMSAVANCEDSOFTWA 89
+           A  +++ +TE    A   D+  T A
+Sbjct: 513 ATETDTTATEADTTATEADTTATEA 537
+
+
+
+ Score = 33.9 bits (76), Expect = 2.6
+ Identities = 24/89 (26%), Positives = 37/89 (41%), Gaps = 6/89 (6%)
+
+Query: 1   EGENETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEM 60
+           E E      ATEA+    E D TA  ++S +TE      ++T  T  +        +
+Sbjct: 448 EAETTAATTATEAETTATEADTTATEADSTATE------ADTTATEADTTATEADTTATE 501
+
+Query: 61  SDATABASESYSTEMSAVANCEDSOFTWA 89
+           +D TA   ++ +TE    A   D+  T A
+Sbjct: 502 ADTTATEDDTTATETDTTATEADTTATEA 530
+
+
+>ref|YP_501439.1| hypothetical protein SAOUHSC_02990 [Staphylococcus aureus subsp.
+            aureus NCTC 8325]
+ sp|Q2FUW1|SRAP_STAA8 Serine-rich adhesin for platelets precursor (Staphylococcus aureus
+            surface protein A)
+ gb|ABD31977.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
+            NCTC 8325]
+          Length = 2271
+
+ Score = 35.0 bits (79), Expect = 1.2
+ Identities = 25/80 (31%), Positives = 43/80 (53%), Gaps = 2/80 (2%)
+
+Query: 5    ETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDAT 64
+            E+E  +    +++ E  +T++ S+S ST  S      T  +  E  + +GS ST +SD+T
+Sbjct: 2039 ESESTSDSTSISDSESLSTSD-SDSTSTSTSDSTSGSTSTSISESLSTSGSGSTSVSDST 2097
+
+Query: 65   ABASESYSTEMSAVANCEDS 84
+            +  SES S+ +S   +  DS
+Sbjct: 2098 S-MSESNSSSVSMSQDKSDS 2116
+
+
+>ref|YP_495223.1| LPXTG-motif cell wall surface anchor family protein [Staphylococcus
+            aureus subsp. aureus USA300]
+ sp|Q2FDK5|SRAP_STAA3 Serine-rich adhesin for platelets precursor (Staphylococcus aureus
+            surface protein A)
+ gb|ABD21900.1| LPXTG-motif cell wall surface anchor family protein [Staphylococcus
+            aureus subsp. aureus USA300]
+          Length = 2271
+
+ Score = 35.0 bits (79), Expect = 1.2
+ Identities = 25/80 (31%), Positives = 43/80 (53%), Gaps = 2/80 (2%)
+
+Query: 5    ETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDAT 64
+            E+E  +    +++ E  +T++ S+S ST  S      T  +  E  + +GS ST +SD+T
+Sbjct: 2039 ESESTSDSTSISDSESLSTSD-SDSTSTSTSDSTSGSTSTSISESLSTSGSGSTSVSDST 2097
+
+Query: 65   ABASESYSTEMSAVANCEDS 84
+            +  SES S+ +S   +  DS
+Sbjct: 2098 S-MSESNSSSVSMSQDKSDS 2116
+
+
+>ref|YP_187464.1| LPXTG cell wall surface anchor family protein [Staphylococcus aureus
+            subsp. aureus COL]
+ sp|Q5HCP3|SRAP_STAAC Serine-rich adhesin for platelets precursor (Staphylococcus aureus
+            surface protein A)
+ gb|AAW38674.1| LPXTG cell wall surface anchor family protein [Staphylococcus aureus
+            subsp. aureus COL]
+          Length = 2261
+
+ Score = 35.0 bits (79), Expect = 1.2
+ Identities = 25/80 (31%), Positives = 43/80 (53%), Gaps = 2/80 (2%)
+
+Query: 5    ETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDAT 64
+            E+E  +    +++ E  +T++ S+S ST  S      T  +  E  + +GS ST +SD+T
+Sbjct: 2029 ESESTSDSTSISDSESLSTSD-SDSTSTSTSDSTSGSTSTSISESLSTSGSGSTSVSDST 2087
+
+Query: 65   ABASESYSTEMSAVANCEDS 84
+            +  SES S+ +S   +  DS
+Sbjct: 2088 S-MSESNSSSVSMSQDKSDS 2106
+
+
+>ref|YP_044654.1| putative cell wall-anchored protein [Staphylococcus aureus subsp.
+            aureus MSSA476]
+ sp|Q6G620|SRAP_STAAS Serine-rich adhesin for platelets precursor (Staphylococcus aureus
+            surface protein A)
+ emb|CAG44357.1| putative cell wall-anchored protein [Staphylococcus aureus subsp.
+            aureus MSSA476]
+          Length = 2275
+
+ Score = 35.0 bits (79), Expect = 1.2
+ Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 2/82 (2%)
+
+Query: 5    ETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDAT 64
+            E+E  +    +++ E  +T++ S+S ST  S      T  +  E  + +GS ST +SD+T
+Sbjct: 2039 ESESTSDSTSISDSESLSTSD-SDSTSTSTSDSTSGSTSTSISESLSTSGSGSTSVSDST 2097
+
+Query: 65   ABASESYSTEMSAVANCEDSOF 86
+            +  SES ST +S   +   S +
+Sbjct: 2098 S-MSESDSTSVSMSQSMSGSTY 2118
+
+
+
+ Score = 32.0 bits (71), Expect = 10.0
+ Identities = 24/74 (32%), Positives = 40/74 (54%), Gaps = 9/74 (12%)
+
+Query: 4    NETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDA 63
+            N T G A+ +   +  +  +   SES ST +S  + + T L+       + S ST +SD+
+Sbjct: 1253 NSTSGSASISTSTSISESTSTFKSESVSTSLS--MSTSTSLSD------STSLSTSLSDS 1304
+
+Query: 64   TABA-SESYSTEMS 76
+            T+++ S+S ST MS
+Sbjct: 1305 TSDSKSDSLSTSMS 1318
+
+
+>ref|NP_647392.1| hypothetical protein MW2575 [Staphylococcus aureus subsp. aureus MW2]
+ sp|Q8NUJ3|SRAP_STAAW Serine-rich adhesin for platelets precursor (Staphylococcus aureus
+            surface protein A)
+ dbj|BAB96440.1| MW2575 [Staphylococcus aureus subsp. aureus MW2]
+          Length = 2275
+
+ Score = 35.0 bits (79), Expect = 1.2
+ Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 2/82 (2%)
+
+Query: 5    ETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDAT 64
+            E+E  +    +++ E  +T++ S+S ST  S      T  +  E  + +GS ST +SD+T
+Sbjct: 2039 ESESTSDSTSISDSESLSTSD-SDSTSTSTSDSTSGSTSTSISESLSTSGSGSTSVSDST 2097
+
+Query: 65   ABASESYSTEMSAVANCEDSOF 86
+            +  SES ST +S   +   S +
+Sbjct: 2098 S-MSESDSTSVSMSQSMSGSTY 2118
+
+
+
+ Score = 32.0 bits (71), Expect = 10.0
+ Identities = 24/74 (32%), Positives = 40/74 (54%), Gaps = 9/74 (12%)
+
+Query: 4    NETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDA 63
+            N T G A+ +   +  +  +   SES ST +S  + + T L+       + S ST +SD+
+Sbjct: 1253 NSTSGSASISTSTSISESTSTFKSESVSTSLS--MSTSTSLSD------STSLSTSLSDS 1304
+
+Query: 64   TABA-SESYSTEMS 76
+            T+++ S+S ST MS
+Sbjct: 1305 TSDSKSDSLSTSMS 1318
+
+
+>gb|AAO84907.1| extracellular matrix protein papilin 2 [Drosophila melanogaster]
+          Length = 2776
+
+ Score = 34.7 bits (78), Expect = 1.5
+ Identities = 20/83 (24%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
+
+Query: 6    TEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDATA 65
+            TE  +     A  +  A++++++S S + +     E+     E +T++ S +T+ S  +
+Sbjct: 948  TENSSDSTSDATSDSTASSDSTDSTSDQTT-ETTPESSTDSTESSTLDASSTTDASSTSE 1006
+
+Query: 66   BASESYSTEMSAVANCEDSOFTW 88
+             +SES +   S  +N   S  TW
+Sbjct: 1007 SSSESSTDGSSTTSNSASSETTW 1029
+
+
+
+ Score = 33.1 bits (74), Expect = 4.5
+ Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 2/84 (2%)
+
+Query: 1    EGENETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEM 60
+            E  + +   +TE       +D T     S STE +  I S+   T  E +T+    S+
+Sbjct: 1057 ESTDGSSNASTEGSTEGASEDTTISTESSGSTESTDAIASDGSTT--EGSTVEDLSSSTS 1114
+
+Query: 61   SDATABASESYSTEMSAVANCEDS 84
+            SD T++++ + S+  + V+   DS
+Sbjct: 1115 SDVTSDSTITDSSPSTEVSGSTDS 1138
+
+
+>gb|AAG37995.1|AF205357_1 extracellular matrix protein papilin [Drosophila melanogaster]
+          Length = 2174
+
+ Score = 34.7 bits (78), Expect = 1.5
+ Identities = 20/83 (24%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
+
+Query: 6    TEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDATA 65
+            TE  +     A  +  A++++++S S + +     E+     E +T++ S +T+ S  +
+Sbjct: 948  TENSSDSTSDATSDSTASSDSTDSTSDQTT-ETTPESSTDSTESSTLDASSTTDASSTSE 1006
+
+Query: 66   BASESYSTEMSAVANCEDSOFTW 88
+             +SES +   S  +N   S  TW
+Sbjct: 1007 SSSESSTDGSSTTSNSASSETTW 1029
+
+
+
+ Score = 33.1 bits (74), Expect = 4.5
+ Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 2/84 (2%)
+
+Query: 1    EGENETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEM 60
+            E  + +   +TE       +D T     S STE +  I S+   T  E +T+    S+
+Sbjct: 1057 ESTDGSSNASTEGSTEGASEDTTISTESSGSTESTDAIASDGSTT--EGSTVEDLSSSTS 1114
+
+Query: 61   SDATABASESYSTEMSAVANCEDS 84
+            SD T++++ + S+  + V+   DS
+Sbjct: 1115 SDVTSDSTITDSSPSTEVSGSTDS 1138
+
+
+>gb|AAO84908.1| extracellular matrix protein papilin 3 [Drosophila melanogaster]
+          Length = 2898
+
+ Score = 34.7 bits (78), Expect = 1.5
+ Identities = 20/83 (24%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
+
+Query: 6    TEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDATA 65
+            TE  +     A  +  A++++++S S + +     E+     E +T++ S +T+ S  +
+Sbjct: 948  TENSSDSTSDATSDSTASSDSTDSTSDQTT-ETTPESSTDSTESSTLDASSTTDASSTSE 1006
+
+Query: 66   BASESYSTEMSAVANCEDSOFTW 88
+             +SES +   S  +N   S  TW
+Sbjct: 1007 SSSESSTDGSSTTSNSASSETTW 1029
+
+
+
+ Score = 33.1 bits (74), Expect = 4.5
+ Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 2/84 (2%)
+
+Query: 1    EGENETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEM 60
+            E  + +   +TE       +D T     S STE +  I S+   T  E +T+    S+
+Sbjct: 1057 ESTDGSSNASTEGSTEGASEDTTISTESSGSTESTDAIASDGSTT--EGSTVEDLSSSTS 1114
+
+Query: 61   SDATABASESYSTEMSAVANCEDS 84
+            SD T++++ + S+  + V+   DS
+Sbjct: 1115 SDVTSDSTITDSSPSTEVSGSTDS 1138
+
+
+>ref|NP_648831.1| CG13075-PA [Drosophila melanogaster]
+ gb|AAF49545.1| CG13075-PA [Drosophila melanogaster]
+ gb|ABJ17014.1| IP10546p [Drosophila melanogaster]
+          Length = 339
+
+ Score = 34.7 bits (78), Expect = 1.5
+ Identities = 24/87 (27%), Positives = 39/87 (44%), Gaps = 7/87 (8%)
+
+Query: 1   EGENETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEM 60
+           +  +++   A+  + ++     TA ++ S STE        TP T    A+ +   STE
+Sbjct: 257 QSPSDSSSTASSTESSSESSSTTASSTASSSTE-------STPTTASSSASSSTESSTES 309
+
+Query: 61  SDATABASESYSTEMSAVANCEDSOFT 87
+           S  TA  ++S STE S  +    S  T
+Sbjct: 310 SSTTASTTQSSSTESSTQSTSTTSTTT 336
+
+
+>gb|AAG00554.1|AF286475_1 retinitis pigmentosa GTPase regulator-like protein [Takifugu
+           rubripes]
+          Length = 791
+
+ Score = 34.3 bits (77), Expect = 2.0
+ Identities = 21/74 (28%), Positives = 33/74 (44%), Gaps = 1/74 (1%)
+
+Query: 1   EGENETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEM 60
+           + E+ETEG   E + ++ E +  ++  E  STE       E   T  E +      STE
+Sbjct: 471 DAESETEGEGAEEEQSSTEKEGESNEEEQSSTEKEESNEEEQSSTEKEESNEEEQSSTE- 529
+
+Query: 61  SDATABASESYSTE 74
+            +  ++  E  STE
+Sbjct: 530 KEGESNEEEQSSTE 543
+
+
+>gb|ABE91554.2| TonB box, N-terminal [Medicago truncatula]
+          Length = 1370
+
+ Score = 33.9 bits (76), Expect = 2.6
+ Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 1/78 (1%)
+
+Query: 1    EGENETEGRATEADVA-NCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTE 59
+            +GE   +  A +A V     +D +A  +ES+    S    S TP+   +  +I+GS + E
+Sbjct: 1290 QGELPEKRDAEDASVKLEANEDGSAKLNESFDVSTSAEETSRTPVDKLDNVSISGSSNKE 1349
+
+Query: 60   MSDATABASESYSTEMSA 77
+             S +   +S S S+  S+
+Sbjct: 1350 KSHSRKSSSSSSSSSSSS 1367
+
+
+>gb|AAQ09848.1| CG10911 [Drosophila yakuba]
+          Length = 268
+
+ Score = 33.9 bits (76), Expect = 2.6
+ Identities = 22/77 (28%), Positives = 39/77 (50%)
+
+Query: 3   ENETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSD 62
+           E+ T+     + V+      ++  S S STE S    +++  +  E +T + S STE S
+Sbjct: 149 ESSTDSSTDSSSVSTESSTDSSTDSSSVSTESSTDSSTDSSSSSTESSTDSSSASTESST 208
+
+Query: 63  ATABASESYSTEMSAVA 79
+            ++  S + STE S+V+
+Sbjct: 209 DSSSDSTASSTESSSVS 225
+
+
+
+ Score = 32.0 bits (71), Expect = 10.0
+ Identities = 21/82 (25%), Positives = 39/82 (47%)
+
+Query: 3   ENETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSD 62
+           E+ T+  +   + +      ++ AS   ST+ S    S +  +  + +T + S STE S
+Sbjct: 78  ESSTDSSSVSTESSTDSSTDSSSASTESSTDSSTDSSSASTESSTDSSTDSSSVSTESST 137
+
+Query: 63  ATABASESYSTEMSAVANCEDS 84
+            ++  S S STE S  ++ + S
+Sbjct: 138 DSSTDSSSVSTESSTDSSTDSS 159
+
+
+>ref|YP_042074.1| putative serine rich repeat containing protein [Staphylococcus aureus
+            subsp. aureus MRSA252]
+ sp|Q6GDE9|SRAP_STAAR Serine-rich adhesin for platelets precursor (Staphylococcus aureus
+            surface protein A)
+ emb|CAG41711.1| putative serine rich repeat containing protein [Staphylococcus aureus
+            subsp. aureus MRSA252]
+          Length = 1351
+
+ Score = 33.5 bits (75), Expect = 3.4
+ Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 1/72 (1%)
+
+Query: 13   ADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDATABASESYS 72
+            +D  +    ++   S+S ST  S      T  +  E  +++GS ST +SD+T+  SES S
+Sbjct: 1112 SDSKSASTASSESISQSVSTSTSGSTSGSTSTSTSESLSMSGSDSTSVSDSTS-MSESDS 1170
+
+Query: 73   TEMSAVANCEDS 84
+            T +S   +  DS
+Sbjct: 1171 TSVSMSQDKSDS 1182
+
+
+>sp|Q868Z9|PPN_DROME Papilin precursor
+          Length = 2898
+
+ Score = 33.1 bits (74), Expect = 4.5
+ Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 2/84 (2%)
+
+Query: 1    EGENETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEM 60
+            E  + +   +TE       +D T     S STE +  I S+   T  E +T+    S+
+Sbjct: 1057 ESTDGSSNASTEGSTEGASEDTTISTESSGSTESTDAIASDGSTT--EGSTVEDLSSSTS 1114
+
+Query: 61   SDATABASESYSTEMSAVANCEDS 84
+            SD T++++ + S+  + V+   DS
+Sbjct: 1115 SDVTSDSTITDSSPSTEVSGSTDS 1138
+
+
+>ref|NP_788751.1| Papilin CG33103-PB, isoform B [Drosophila melanogaster]
+ gb|AAF56794.3| CG33103-PB, isoform B [Drosophila melanogaster]
+          Length = 2772
+
+ Score = 33.1 bits (74), Expect = 4.5
+ Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 2/84 (2%)
+
+Query: 1    EGENETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEM 60
+            E  + +   +TE       +D T     S STE +  I S+   T  E +T+    S+
+Sbjct: 1057 ESTDGSSNASTEGSTEGASEDTTISTESSGSTESTDAIASDGSTT--EGSTVEDLSSSTS 1114
+
+Query: 61   SDATABASESYSTEMSAVANCEDS 84
+            SD T++++ + S+  + V+   DS
+Sbjct: 1115 SDVTSDSTITDSSPSTEVSGSTDS 1138
+
+
+>ref|NP_648504.2| CG6004-PB [Drosophila melanogaster]
+ gb|AAL68190.1| GH09355p [Drosophila melanogaster]
+ gb|AAF50015.3| CG6004-PB [Drosophila melanogaster]
+          Length = 1514
+
+ Score = 33.1 bits (74), Expect = 4.5
+ Identities = 29/91 (31%), Positives = 45/91 (49%), Gaps = 8/91 (8%)
+
+Query: 1    EGENETEGR-ATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTE 59
+            E  + TEG  +TE+      + ++ ++S+  +T+ S    +E+PL+       N S STE
+Sbjct: 976  ESSSSTEGPLSTESSTEGSNESSSTESSQDSTTQES-SSSTESPLSTEPSTEANESSSTE 1034
+
+Query: 60   MS-DATABASES-----YSTEMSAVANCEDS 84
+             S D+T   S S      STE S  A+ E S
+Sbjct: 1035 SSQDSTTQESSSSTEGPLSTESSTEASNESS 1065
+
+
+
+ Score = 32.7 bits (73), Expect = 5.8
+ Identities = 28/87 (32%), Positives = 43/87 (49%), Gaps = 8/87 (9%)
+
+Query: 1   EGENETEGR-ATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTE 59
+           E  + TEG  +TE+      + ++ ++S+  +T+ S    +E+PL+       N S STE
+Sbjct: 610 ESSSSTEGPLSTESSTEGSNESSSTESSQDSTTQKS-SSSTESPLSTEPSTEANESSSTE 668
+
+Query: 60  MS-DATABASES-----YSTEMSAVAN 80
+            S D+T   S S      STE S  AN
+Sbjct: 669 SSQDSTTQESSSSTEGPLSTEPSTEAN 695
+
+
+
+ Score = 32.7 bits (73), Expect = 5.8
+ Identities = 28/87 (32%), Positives = 43/87 (49%), Gaps = 8/87 (9%)
+
+Query: 1   EGENETEGR-ATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTE 59
+           E  + TEG  +TE+      + ++ ++S+  +T+ S    +E+PL+       N S STE
+Sbjct: 876 ESSSSTEGPLSTESSTEGSNESSSTESSQDSTTQES-SSSTESPLSTEPSTEANESSSTE 934
+
+Query: 60  MS-DATABASES-----YSTEMSAVAN 80
+            S D+T   S S      STE S  AN
+Sbjct: 935 SSQDSTTQESSSSTEGPLSTESSTEAN 961
+
+
+
+ Score = 32.3 bits (72), Expect = 7.6
+ Identities = 28/90 (31%), Positives = 40/90 (44%), Gaps = 7/90 (7%)
+
+Query: 1   EGENETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEM 60
+           E  + TEG  +        + ++ ++S+  +T+ S    SE PL+       N S STE
+Sbjct: 776 ESSSSTEGPLSTEPSTEANESSSTESSQDSTTQES-SSSSEGPLSTESSTEANESSSTES 834
+
+Query: 61  S-DATABASES-----YSTEMSAVANCEDS 84
+           S D+T   S S      STE S  A  E S
+Sbjct: 835 SQDSTTQESSSSTEDPLSTESSTEATYESS 864
+
+
+>ref|NP_788752.1| Papilin CG33103-PA, isoform A [Drosophila melanogaster]
+ gb|AAF56795.3| CG33103-PA, isoform A [Drosophila melanogaster]
+          Length = 2894
+
+ Score = 33.1 bits (74), Expect = 4.5
+ Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 2/84 (2%)
+
+Query: 1    EGENETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEM 60
+            E  + +   +TE       +D T     S STE +  I S+   T  E +T+    S+
+Sbjct: 1057 ESTDGSSNASTEGSTEGASEDTTISTESSGSTESTDAIASDGSTT--EGSTVEDLSSSTS 1114
+
+Query: 61   SDATABASESYSTEMSAVANCEDS 84
+            SD T++++ + S+  + V+   DS
+Sbjct: 1115 SDVTSDSTITDSSPSTEVSGSTDS 1138
+
+
+>ref|XP_001384983.1| predicted protein [Pichia stipitis CBS 6054]
+ gb|ABN66954.1| predicted protein [Pichia stipitis CBS 6054]
+          Length = 240
+
+ Score = 32.7 bits (73), Expect = 5.8
+ Identities = 23/74 (31%), Positives = 33/74 (44%), Gaps = 3/74 (4%)
+
+Query: 4   NETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDA 63
+           +  E  +TE+  A       +   ES STE +    S  P +  E AT     STE S
+Sbjct: 95  SSAESSSTESSSAESSSTEASSTEESSSTEET---SSAEPSSSSEEATSTEESSTEESST 151
+
+Query: 64  TABASESYSTEMSA 77
+              ++E+ STE S+
+Sbjct: 152 EESSAEATSTEESS 165
+
+
+>gb|AAH75165.1| LOC443724 protein [Xenopus laevis]
+          Length = 747
+
+ Score = 32.7 bits (73), Expect = 5.8
+ Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
+
+Query: 1   EGENETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEM 60
+           E     + +AT+ ++AN E  +    S+S   E      SET     E +      S+E
+Sbjct: 665 EPSEPVKNKATKLEMANSEKSSDKFYSDSEQEEKESEESSETESESEEDSDNEKESSSEQ 724
+
+Query: 61  SDATABA-SESYSTEMSA 77
+           SDA++ A SES S E S+
+Sbjct: 725 SDASSSAESESESDESSS 742
+
+
+>gb|AAF87093.1|AF167576_1 secreted antigen SagBb [Enterococcus hirae]
+          Length = 576
+
+ Score = 32.7 bits (73), Expect = 5.8
+ Identities = 24/80 (30%), Positives = 34/80 (42%), Gaps = 2/80 (2%)
+
+Query: 1   EGENETEGRATEADVANCEDDATABASESY--STEMSWHIMSETPLTOPERATINGSYST 58
+           E    TE   T  +  + E   T + S S   ST       +E+  T  E  +   S +T
+Sbjct: 309 EESTSTESSTTTEESTSTESSTTTEESTSTESSTTTEESTSTESSTTTEESTSTESSTTT 368
+
+Query: 59  EMSDATABASESYSTEMSAV 78
+           E S   + ++ES STE S V
+Sbjct: 369 ENSSTGSSSTESSSTEESTV 388
+
+
+>gb|AAI10711.1| LOC443724 protein [Xenopus laevis]
+          Length = 752
+
+ Score = 32.7 bits (73), Expect = 5.8
+ Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
+
+Query: 1   EGENETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEM 60
+           E     + +AT+ ++AN E  +    S+S   E      SET     E +      S+E
+Sbjct: 665 EPSEPVKNKATKLEMANSEKSSDKFYSDSEQEEKESEESSETESESEEDSDNEKESSSEQ 724
+
+Query: 61  SDATABA-SESYSTEMSA 77
+           SDA++ A SES S E S+
+Sbjct: 725 SDASSSAESESESDESSS 742
+
+
+>ref|XP_847865.1| hypothetical protein LMJ_0842 [Leishmania major strain Friedlin]
+ gb|AAZ09657.1| hypothetical protein, conserved [Leishmania major strain Friedlin]
+          Length = 536
+
+ Score = 32.7 bits (73), Expect = 5.8
+ Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 8/79 (10%)
+
+Query: 4   NETEGRATEADVANCEDDATAB-------ASESYSTEMSWHIMSETPLTOPERATINGSY 56
+           +E+E R+++A V++   D TA        ASE  + ++ W + + T L       + G +
+Sbjct: 339 HESEKRSSDA-VSSSGSDKTAPLQRMQSLASERRTEDVGWRLFALTVLQKTTTLILRGCF 397
+
+Query: 57  STEMSDATABASESYSTEM 75
+           +T   DAT  + +S S E+
+Sbjct: 398 TTSTGDATNASQDSTSAEI 416
+
+
+>gb|AAH94141.1| LOC443724 protein [Xenopus laevis]
+          Length = 1099
+
+ Score = 32.7 bits (73), Expect = 5.8
+ Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
+
+Query: 1   EGENETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEM 60
+           E     + +AT+ ++AN E  +    S+S   E      SET     E +      S+E
+Sbjct: 665 EPSEPVKNKATKLEMANSEKSSDKFYSDSEQEEKESEESSETESESEEDSDNEKESSSEQ 724
+
+Query: 61  SDATABA-SESYSTEMSA 77
+           SDA++ A SES S E S+
+Sbjct: 725 SDASSSAESESESDESSS 742
+
+
+>ref|YP_189831.1| serine threonine rich antigen [Staphylococcus epidermidis RP62A]
+ gb|AAW53156.1| serine threonine rich antigen [Staphylococcus epidermidis RP62A]
+          Length = 1870
+
+ Score = 32.7 bits (73), Expect = 5.8
+ Identities = 21/74 (28%), Positives = 41/74 (55%), Gaps = 2/74 (2%)
+
+Query: 4    NETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDA 63
+            +E+E  +    V+     + ++++ + ++E +    SE+  T  E  +++GS ST +SD+
+Sbjct: 1475 SESESTSESTSVSESSSTSVSDSTSTSTSESASTSTSESESTS-ESTSLSGSSSTSVSDS 1533
+
+Query: 64   TA-BASESYSTEMS 76
+            T+   SES ST  S
+Sbjct: 1534 TSTSTSESASTSTS 1547
+
+
+>ref|NP_765804.1| streptococcal hemagglutinin protein [Staphylococcus epidermidis ATCC
+            12228]
+ gb|AAO05891.1|AE016751_186 streptococcal hemagglutinin protein [Staphylococcus epidermidis ATCC
+            12228]
+          Length = 2310
+
+ Score = 32.3 bits (72), Expect = 7.6
+ Identities = 20/74 (27%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
+
+Query: 6    TEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDATA 65
+            +E  +T   V++  + A+   SES ST +S    + T  +  E A+ + S ST +SD+T+
+Sbjct: 1779 SESASTSTSVSD-SNSASTSLSESTSTSLSGSTSTSTSDSASESASESESTSTSVSDSTS 1837
+
+Query: 66   BASESYSTEMSAVA 79
+             ++ +  +E ++ +
+Sbjct: 1838 ASTSTSESESNSTS 1851
+
+
+>ref|NP_611286.1| CG10911-PA [Drosophila melanogaster]
+ gb|AAF57760.1| CG10911-PA [Drosophila melanogaster]
+ gb|AAM48399.1| RE12410p [Drosophila melanogaster]
+          Length = 359
+
+ Score = 32.3 bits (72), Expect = 7.6
+ Identities = 23/86 (26%), Positives = 45/86 (52%), Gaps = 3/86 (3%)
+
+Query: 1   EGENETEGRATEA--DVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYST 58
+           +   ++   +TE+  D ++   +++ ++S S STE S    +++     E +T + S ST
+Sbjct: 203 DSSTDSTSASTESSTDSSSVSTESSTDSS-SVSTESSTDSSTDSSSASTESSTDSSSVST 261
+
+Query: 59  EMSDATABASESYSTEMSAVANCEDS 84
+           E S  ++  S S STE S  ++ + S
+Sbjct: 262 ESSTDSSTDSSSVSTESSTDSSTDSS 287
+
+
+>ref|YP_394895.1| Hypothetical lipoprotein precursor [Lactobacillus sakei subsp.
+           sakei 23K]
+ emb|CAI54583.1| Hypothetical lipoprotein precursor [Lactobacillus sakei subsp.
+           sakei 23K]
+          Length = 207
+
+ Score = 32.3 bits (72), Expect = 7.6
+ Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 5/75 (6%)
+
+Query: 10  ATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDATABASE 69
+           ++E+ V + +  + +  ++S S+E S   +SE+  T     T   S +   +D+T+  S+
+Sbjct: 32  SSESKVTSVKKTSHSKKAQSQSSEES---VSES--TSDSEVTSQSSQTPSATDSTSTVSQ 86
+
+Query: 70  SYSTEMSAVANCEDS 84
+           S ST+ S VAN + S
+Sbjct: 87  SASTQSSQVANSQSS 101
+
+
+>ref|NP_496184.1| Location Of Vulva defective family member (lov-1) [Caenorhabditis
+           elegans]
+ sp|Q09624|YS89_CAEEL Hypothetical protein ZK945.9
+ emb|CAB70201.1| Hypothetical protein ZK945.9 [Caenorhabditis elegans]
+ emb|CAB70192.1| Hypothetical protein ZK945.9 [Caenorhabditis elegans]
+          Length = 3178
+
+ Score = 32.3 bits (72), Expect = 7.6
+ Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 2/74 (2%)
+
+Query: 6   TEGRATEADVANCEDDATABAS--ESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDA 63
+           TE  +T + V   E   T   S   + +TE S   ++ +P T P  +T+  S S+  +
+Sbjct: 414 TEVTSTSSTVTTTEPTTTLTTSTASTSTTEPSTSTVTTSPSTSPVTSTVTSSSSSSTTVT 473
+
+Query: 64  TABASESYSTEMSA 77
+           T  ++ES ST  S+
+Sbjct: 474 TPTSTESTSTSPSS 487
+
+
+>pir||T21460 hypothetical protein ZK945.10 - Caenorhabditis elegans
+          Length = 796
+
+ Score = 32.3 bits (72), Expect = 7.6
+ Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 2/74 (2%)
+
+Query: 6   TEGRATEADVANCEDDATABAS--ESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDA 63
+           TE  +T + V   E   T   S   + +TE S   ++ +P T P  +T+  S S+  +
+Sbjct: 414 TEVTSTSSTVTTTEPTTTLTTSTASTSTTEPSTSTVTTSPSTSPVTSTVTSSSSSSTTVT 473
+
+Query: 64  TABASESYSTEMSA 77
+           T  ++ES ST  S+
+Sbjct: 474 TPTSTESTSTSPSS 487
+
+
+>ref|XP_001355356.1| GA18086-PA [Drosophila pseudoobscura]
+ gb|EAL32413.1| GA18086-PA [Drosophila pseudoobscura]
+          Length = 1300
+
+ Score = 32.3 bits (72), Expect = 7.6
+ Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 10/81 (12%)
+
+Query: 4   NETEGRAT----EADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTE 59
+           N + GRAT     +        AT +A+E+ +TE       +      ++ TI    S+
+Sbjct: 615 NASGGRATTPTTSSGTVTATATATGNANENANTE------DQNQNQNHKQKTIKAMSSSS 668
+
+Query: 60  MSDATABASESYSTEMSAVAN 80
+             D+TA+ ++S+  +MSA AN
+Sbjct: 669 SFDSTANLNQSFRYKMSAEAN 689
+
+
+>ref|XP_768937.1| hypothetical protein GLP_561_28660_36852 [Giardia lamblia ATCC
+           50803]
+ gb|EAA38821.1| GLP_561_28660_36852 [Giardia lamblia ATCC 50803]
+          Length = 2730
+
+ Score = 32.3 bits (72), Expect = 7.6
+ Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
+
+Query: 15  VANCEDDATABASESYSTEMSWH-IMSETPLTOPERATINGSYSTEMSDATABASESYST 73
+           V + ED AT +   +   ++ W   +S+TP T    AT+   Y   +S   A+ +E+Y+
+Sbjct: 317 VLSDEDAATLEWVVTKMNQIKWSSTISQTPKTKTTSATVTEIYEEYVSLMKAERNEAYAA 376
+
+Query: 74  EMS 76
+           EMS
+Sbjct: 377 EMS 379
+
+
+>ref|XP_001369233.1| PREDICTED: similar to neuron growth-associated protein 43
+           [Monodelphis domestica]
+          Length = 253
+
+ Score = 32.0 bits (71), Expect = 10.0
+ Identities = 27/87 (31%), Positives = 41/87 (47%), Gaps = 5/87 (5%)
+
+Query: 1   EGENETEGRATEADVANCEDD--ATABASESYSTEMSWHIMSETPLTOP--ERATINGSY 56
+           +GE + + RA EAD    +D+  ATA+A E   +E         P+  P  E A+  G
+Sbjct: 63  KGEKKGDARAAEADANEKKDEAAATADAVEKKESEAP-AATEAAPVDGPKAEEASKAGES 121
+
+Query: 57  STEMSDATABASESYSTEMSAVANCED 83
+           ++E  +A A A+ S      A A  E+
+Sbjct: 122 TSEEKEAGAPAAASEQPAPKATAPSEE 148
+
+
+>ref|YP_696758.1| bacterial extracellular solute-binding protein [Clostridium
+          perfringens ATCC 13124]
+ gb|ABG83438.1| bacterial extracellular solute-binding protein [Clostridium
+          perfringens ATCC 13124]
+          Length = 482
+
+ Score = 32.0 bits (71), Expect = 10.0
+ Identities = 17/74 (22%), Positives = 31/74 (41%), Gaps = 4/74 (5%)
+
+Query: 11 TEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDATABAS-- 68
+          T   +  C  D TA+A E  + +++W+ + +TP            Y  E  +AT +
+Sbjct: 18 TSVALTGCGADKTANAGEGETVKLTWYTIGQTPKDLDMVQEKANEYLKEKINATIDMKFI 77
+
+Query: 69 --ESYSTEMSAVAN 80
+              Y+ +M  + N
+Sbjct: 78 DYGDYTQKMGVIIN 91
+
+
+>ref|XP_453348.1| unnamed protein product [Kluyveromyces lactis]
+ emb|CAH00444.1| unnamed protein product [Kluyveromyces lactis NRRL Y-1140]
+          Length = 1423
+
+ Score = 32.0 bits (71), Expect = 10.0
+ Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 12/85 (14%)
+
+Query: 3   ENETEGRATEA--------DVANCEDDATABA---SESYSTEMSWHIMSETPLTOPERAT 51
+           EN + G +TE+        DV+  E  +T +A   SE+ ST  S    SE+P +  + +T
+Sbjct: 481 ENVSTGESTESSESPTSTEDVSTDESTSTTEAASTSENVSTAESTE-SSESPTSTEDVST 539
+
+Query: 52  INGSYSTEMSDATABASESYSTEMS 76
+              + +TE +  + + S + STE S
+Sbjct: 540 DESTSTTEAASTSENVSTAESTESS 564
+
+
+>gb|AAB41404.1| adenomatous polyposis coli [Drosophila melanogaster]
+          Length = 2416
+
+ Score = 32.0 bits (71), Expect = 10.0
+ Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 2/67 (2%)
+
+Query: 10   ATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDATABASE 69
+            A ++ V N E D   +   SY TE +  ++S+ P       ++    ST+  DATA  ++
+Sbjct: 1126 AVKSTVVNSEVDVAEETIRSYCTEDTPALLSKVPSNT--NLSVISMSSTDPKDATAGQAQ 1183
+
+Query: 70   SYSTEMS 76
+             Y+ ++S
+Sbjct: 1184 MYAHQLS 1190
+
+
+>ref|NP_477152.1| APC-like CG1451-PA [Drosophila melanogaster]
+ gb|AAF56820.1| CG1451-PA [Drosophila melanogaster]
+          Length = 2417
+
+ Score = 32.0 bits (71), Expect = 10.0
+ Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 2/67 (2%)
+
+Query: 10   ATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDATABASE 69
+            A ++ V N E D   +   SY TE +  ++S+ P       ++    ST+  DATA  ++
+Sbjct: 1127 AVKSTVVNSEVDVAEETIRSYCTEDTPALLSKVPSNT--NLSVISMSSTDPKDATAGQAQ 1184
+
+Query: 70   SYSTEMS 76
+             Y+ ++S
+Sbjct: 1185 MYAHQLS 1191
+
+
+>ref|XP_501626.1| hypothetical protein [Yarrowia lipolytica]
+ emb|CAG81929.1| unnamed protein product [Yarrowia lipolytica CLIB122]
+          Length = 1347
+
+ Score = 32.0 bits (71), Expect = 10.0
+ Identities = 24/110 (21%), Positives = 43/110 (39%), Gaps = 5/110 (4%)
+
+Query: 22  ATABASESYSTEMSWHIMSETPLTOP-----ERATINGSYSTEMSDATABASESYSTEMS 76
+           + A +S + S+  S  ++S TP++       E  T+NG+ STE  D  A +S       +
+Sbjct: 695 SAAVSSAAVSSTPSVSLVSSTPVSIDTCIETETVTVNGTVSTETKDVCATSSTPAPVSTN 754
+
+Query: 77  AVANCEDSOFTWAXXXXXXXXXXXXXPREDICTPROTEINHAVEANICED 126
+                E +  +               P  D CT   T +++     + +D
+Sbjct: 755 TCIEVETTTVSGTASTVTKDVCASTTPSADPCTEVVTVLSNGTTTVVTKD 804
+
+
+>ref|NP_562994.1| hypothetical protein CPE2078 [Clostridium perfringens str. 13]
+ dbj|BAB81784.1| conserved hypothetical protein [Clostridium perfringens str. 13]
+          Length = 482
+
+ Score = 32.0 bits (71), Expect = 10.0
+ Identities = 17/74 (22%), Positives = 31/74 (41%), Gaps = 4/74 (5%)
+
+Query: 11 TEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDATABAS-- 68
+          T   +  C  D TA+A E  + +++W+ + +TP            Y  E  +AT +
+Sbjct: 18 TSVALTGCGADKTANAGEGETVKLTWYTIGQTPKDLDMVQEKANEYLKEKINATIDMKFI 77
+
+Query: 69 --ESYSTEMSAVAN 80
+              Y+ +M  + N
+Sbjct: 78 DYGDYTQKMGVIIN 91
+
+
+>ref|XP_640638.1| hypothetical protein DDBDRAFT_0204669 [Dictyostelium discoideum
+           AX4]
+ gb|EAL66652.1| hypothetical protein DDBDRAFT_0204669 [Dictyostelium discoideum
+           AX4]
+          Length = 620
+
+ Score = 32.0 bits (71), Expect = 10.0
+ Identities = 19/66 (28%), Positives = 37/66 (56%)
+
+Query: 11  TEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDATABASES 70
+           +E++  +   +  +++S SYS+E S    SE+  +    +  + SYS+E   + + + ES
+Sbjct: 209 SESNSESYSSEFNSESSGSYSSESSGSYSSESSGSESSGSYSSESYSSESYSSESYSPES 268
+
+Query: 71  YSTEMS 76
+           YS+E S
+Sbjct: 269 YSSESS 274
+
+
+  Database: All non-redundant GenBank CDS
+  translations+PDB+SwissProt+PIR+PRF excluding environmental samples
+  from WGS projects
+    Posted date:  May 9, 2007  5:55 PM
+  Number of letters in database: 1,693,139,330
+  Number of sequences in database:  4,904,269
+
+Lambda     K      H
+   0.307    0.119    0.000
+
+Gapped
+Lambda     K      H
+   0.267   0.0410 4.94e-324
+
+Matrix: BLOSUM62
+Gap Penalties: Existence: 11, Extension: 1
+Number of Sequences: 4904269
+Number of Hits to DB: 16864086
+Number of extensions: 467301
+Number of successful extensions: 1176
+Number of sequences better than 10: 2
+Number of HSP's better than 10 without gapping: 0
+Number of HSP's gapped: 1221
+Number of HSP's successfully gapped: 3
+Length of query: 138
+Length of database: 1693139330
+Length adjustment: 103
+Effective length of query: 35
+Effective length of database: 1187999623
+Effective search space: 41579986805
+Effective search space used: 41579986805
+T: 11
+A: 40
+X1: 16 (7.1 bits)
+X2: 38 (14.6 bits)
+X3: 64 (24.7 bits)
+S1: 42 (20.8 bits)
+S2: 71 (32.0 bits)
+
diff --git a/geneWKspace/Genetegrate/compile.sh b/geneWKspace/Genetegrate/compile.sh
new file mode 100644
index 0000000..ca706b0
--- /dev/null
+++ b/geneWKspace/Genetegrate/compile.sh
@@ -0,0 +1,9 @@
+export CLASSPATH=/nfs/home1/ssheth/Code/
+javac -d . source/*.java
+javac -d . middleware/*.java
+javac -d . services/*.java
+
+javac -d . client/*.java
+
+rmic middleware.CPUTorrentRMIServer
+cp middleware/CPUTorrentRMIServer_Stub.class client/
\ No newline at end of file
diff --git a/geneWKspace/Genetegrate/fasta1.f b/geneWKspace/Genetegrate/fasta1.f
new file mode 100644
index 0000000..32bb2e4
--- /dev/null
+++ b/geneWKspace/Genetegrate/fasta1.f
@@ -0,0 +1,4 @@
+>1tof_
+GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCG
+PCKMIAPLFETLSNDYAGKVIFLKVDVDAVAAVAEAA
+GITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA
\ No newline at end of file
diff --git a/geneWKspace/Genetegrate/fasta2.f b/geneWKspace/Genetegrate/fasta2.f
new file mode 100644
index 0000000..853ed99
--- /dev/null
+++ b/geneWKspace/Genetegrate/fasta2.f
@@ -0,0 +1,2 @@
+>1V76:A
+GAHRGRVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWKVPKDVSIFEFEADDGTKIKIPGERLVGRPEMRLKKRWKKW
\ No newline at end of file
diff --git a/geneWKspace/Genetegrate/fasta3.f b/geneWKspace/Genetegrate/fasta3.f
new file mode 100644
index 0000000..cb81399
--- /dev/null
+++ b/geneWKspace/Genetegrate/fasta3.f
@@ -0,0 +1,4 @@
+>gi|129295|sp|P01013|OVAX_CHICK GENE X PROTEIN (OVALBUMIN-RELATED)    QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE
+KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS
+VLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP
+FLFLIKHNPTNTIVYFGRYWSP
\ No newline at end of file
diff --git a/geneWKspace/Genetegrate/fasta4.f b/geneWKspace/Genetegrate/fasta4.f
new file mode 100644
index 0000000..eb77c1c
--- /dev/null
+++ b/geneWKspace/Genetegrate/fasta4.f
@@ -0,0 +1,2 @@
+>fasta4
+BHAVESHRAMESHPATIRAAARONFERNANDESSWAPNEELSHETHSHRUTHIGANDHIGAILKAISERGUYYACHDAVEYALMOSESBURKHARDROSTDAVIDWOLTZJULIASTOYANOVICHKENNETHGROSS
\ No newline at end of file
diff --git a/geneWKspace/Genetegrate/fasta5.f b/geneWKspace/Genetegrate/fasta5.f
new file mode 100644
index 0000000..c39ff20
--- /dev/null
+++ b/geneWKspace/Genetegrate/fasta5.f
@@ -0,0 +1,2 @@
+>fasta5
+EGENETEGRATEADVANCEDDATABASESYSTEMSWHIMSETPLTOPERATINGSYSTEMSDATABASESYSTEMSAVANCEDSOFTWAREENGINEERINGPREDICTPROTEINHAVEANICEDAYHELLOWORLD
\ No newline at end of file